Why does A Sphere visit Flatland?

Answers

Answer 1

The Sphere's visit is motivated by a desire to enlighten the Flatlanders about the limitations of their perception and understanding of reality. The Sphere tries to help them understand that there are more dimensions beyond their own, which they cannot see or comprehend.

What is the Sphere?

In the book "Flatland: A Romance of Many Dimensions" by Edwin A. Abbott, a Sphere visits Flatland to educate its inhabitants about the existence of higher dimensions beyond their two-dimensional world. The Sphere represents a three-dimensional object, which is completely foreign to the two-dimensional inhabitants of Flatland.

Therefore, Through the character of the Sphere, the author is trying to convey the idea that humans, like the Flatlanders, may be limited by their perceptions and understanding of reality. The Sphere's visit serves as a metaphor for the importance of expanding our minds and considering alternative perspectives, even if they may be difficult to comprehend or outside of our current understanding.

Learn more about Sphere on:

https://brainly.com/question/30963439

#SPJ1


Related Questions

What will happen to the electronic items after 100 years

Answers

It's hard to say for sure what will happen to electronic devices in 100 years because of technology developments and shifts in society beliefs about sustainability and waste that could have a big influence on their destiny.

Nonetheless, it is conceivable that many modern electronic devices won't function or be useful in 100 years based on existing trends and hypotheses. Due to the rapid evolution of technology, many gadgets rapidly become obsolete and are replaced by newer, more sophisticated models. Also, if they are not properly stored or disposed of, the materials used to build electronic gadgets can degrade over time.

Particularly if they are uncommon or noteworthy in terms of technological or cultural history, some electrical objects may become priceless antiquities or antiques. Others could be recycled or used again since they contain valuable materials or components. It's also possible that future technological developments could enable the production of more durable, long-lasting electrical devices that are meant to last for millennia rather than just a few years.

Learn more about Electronic items

https://brainly.com/question/17256369

#SPJ4

Quality of good relationship on setting life goals

Answers

A good relationship is essential for setting life goals. Good communication, trust and respect are the foundations of any successful relationship and setting life goals together.

Understanding one another's expectations and needs is crucial for developing a strategy to achieve the shared goals. Also, it's critical to support one another, inspire and encourage one another to achieve the goals, and come together to celebrate accomplishments. Set goals; it's that easy. What purposes serve relationships? Relationship objectives are the things a couple desires to experience, accomplish, or learn. Relationship goals establish the groundwork for a better, healthier bond and provide every relationship with a target to strive for. Because they provide you with a strong sense of drive and aid in developing a long-term vision for your life, setting life goals is crucial.

TO know more about inspire refer :

brainly.com/question/30133974

#SPJ4

Can anybody help me with all of them ( the last one number 3 says write a sentence alter in the fourth position)

Answers

Answer:

1. "The reckless driver caused a violent collision when they failed to stop at the red light."

2. "The landscape was breathtaking, with jagged peaks towering above."

3. "She had to alter her dress by herself."

First ones (that are shown at the top):

If we alter our plans now, we might be able to avoid the traffic.

One invariable rule at our house is to always wash your hands before dinner.

We all felt a jolt when the earthquake hit.

The desert landscape was graced by a beautiful sunset.

Something that is like a mantle of stars covered the night sky.

My most obtainable goal for this year is to read one book per month.

A raised hand is often the signal that someone wants to speak.

This may not be achievable, but someday I want to travel to every continent in the world.

Hope this helps! If not, I'm sorry! :]

 An old man had three sons. When they had grown into manhood, he called them together. He ordered them to go out and bring him food and clothing since he was no longer able to provide for himself.
The three brothers set out. After a very long while, they came to a large river. They decided to cross the river and then each go their separate ways. In a year's time, they would all meet at the same spot.
So, the brothers parted. At the end of the year, they lound their way back to the riverside. The oldest brother asked the youngest brother what he had found during his travels. The boy replied, " have a mirror it you look into it, you can see all over the country"
When the second brother was asked what he had round, he replied, "I have a pair of sandals. If one puts them on, one can walk to any place in the country in one step"
Then the oldest brother said, "I have a small bag of medicine, that is all But let us look into the mirror and see how our father is."
The three brothers looked into the mirror and saw that their father was dead. The oldest brother said, "Let us hurry. home and see what we can do."
So the second brother brought out his sandals, and all three placed their feet inside them. Immediately, they raced to their father's grave. Then the oldest brother shook the medicine out of its bag and poured it over the grave.
At once their father stood before them. It was as if nothing had ever been the matter with him.


how was the medicine bad different from the sandals?

A - only the sandals had special power


B - only the medicine bad could bring back the father to life.

C - only the medicine bag was found during the brothers travels.



100 POINTS

11 MIN DUE

Answers

Martin, a young boy, receives a prized family treasure in "The Medicine Bag" that symbolizes the transition from boy to man.

What does the medical bag in the fable "Medicine Bag" mean?

From one generation of males to the next, the medicine bag is passed down. It stands for the heritage and vision of their family. The Sioux place a great deal of cultural value on the medicine bag. The grandfather and the family's Lakota roots are represented through the medicine bag in the narrative.

What distinctions exist between the medicine bag and the Rite of Passage for Apache Girls?

In "The Medicine Bag," a child named Martin learns about his family's custom from his grandfather and expresses his feelings about it. Aztec Girls'

To know more about sandals visit:

https://brainly.com/question/28325693

#SPJ1

Help me Pleaseeeeeeeeeeee

Answers

Answer:

1.) A roof over our head - This idiom means to have a place to live or shelter.

Example sentence: After being homeless for months, I finally found a small apartment with a roof over my head.

2.) Hanging over my head - This idiom means a problem or a worry that someone has that they can't stop thinking about.

Example sentence: I hate having this project hanging over my head all weekend, I wish I could just finish it now.

what is the most accurate translation of this sentence using standard sentence structure
A) Do you judge my size?
B)Judge my size do you?
C) Do you judge me by my size?

Answers

Answer:

i believe the answer is C

hope this helps <3

I believe the answer would be C. It sounds the most accurate.

Hope this helped you!

8a Complete the conversation with the Present continuous form of the verb in brackets. S= Sophie J = Jenny S: It's me, Sophie. J: Hi, Sophie. Where are you? What are you doing you do)? S: I'm at my sister's wedding. J: Fantastic! 2 yourself? S: No, ³ ve) a good time. It's awful! J: Why? What s (happen)? S: Well, there's the music, for a start. They 6 oh no, I don't believe it! My dad 7 S: No, 5 J: How about your mum? 8_ dance), too? J: Oh dear! (you / enjoy) (play) this awful 80s music and ... (not do) anything. She 11 my dad. J: Sophie, what 13 S: He 14 later. Bye! (dance) with my mum's sister! (she/ (not She 10 S: Just a minute... There's a very good-looking young man over there. There's a girl talking to him but he .(not listen) and... oh! 12 (look) at (he/do)? (come over)! Talk to you​

Answers

The complete conversation in Present continuous form of the verbs are;

S: It's me, Sophie.

J: Hi, Sophie. Where are you? What are you doing (you do)?

S: I'm at my sister's wedding.

J: Fantastic! Are you enjoying yourself?

S: No, I'm not having a good time. It's awful!

J: Why? What's happening?

S: Well, there's the music, for a start. They are playing this awful 80s music and... oh no, I don't believe it! My dad is dancing with my mum's sister!

J: Oh dear! Is your mum enjoying herself, too?

S: She's not doing anything. She's just sitting there and not enjoying this awful music.

J: Sophie, what is your dad doing now?

S: He is dancing with my mum's sister!

J: How about you? Are you enjoying this music and dancing?

S: Just a minute... There's a very good-looking young man over there. There's a girl talking to him but he is not listening and... oh! He is looking at me! He is coming over! Talk to you later. Bye!

What does Present continuous form of a verb mean?

The present continuous form of a verb is used to describe actions or situations that are happening now or are currently in progress. It is formed using the auxiliary verb "to be" in the present tense (am, is, are) and the present participle (-ing) form of the main verb. For example, "I am typing on my computer" or "She is studying for her exam."

Find more useful information on  present continuous form of a verb;

https://brainly.com/question/23245856

#SPJ1

This comes from the "I have a Dream" speech in commonlit:
PART A: Which of the following identifies the central idea of the text?

A. King believes that African Americans should not be denied their civil rights, and

encourages others to be relentless in their non-violent fight for freedom.

B. King's dream is for African Americans to be free, and makes it clear he will do anything to achieve this, no matter the consequences.

C. King does not believe that America is ready to grant African Americans their freedom, but is hopeful for a future in which this is possible.

D. King knows that equality is not something he will see during his lifetime, but is

confident that his children will eventually live in a world of equality.


2. PART B: Which detail from the text best supports the answer to Part A?

A. "But one hundred years later, the Negro still is not free. One hundred years later, the life of the Negro is still sadly crippled by the manacles of segregation and the chains of discrimination." (Paragraph 3)

B. "In the process of gaining our rightful place, we must not be guilty of wrongful deeds. Let us not seek to satisfy our thirst for freedom by drinking from the cup of bitterness and hatred." (Paragraph 8)

C. "I am not unmindful that some of you have come here out of great trials and

tribulations. Some of you have come fresh from narrow jail cells." (Paragraph 14)

D. "I have a dream that my four little children will one day live in a nation where they will not be judged by the color of their skin but by the content of their character."

(Paragraph 20)


3. PART A: What is the meaning of "tribulation" in paragraph 14?

A. adventure

B. uncertainty

C. difficulty

D. desperation


4. PART B: Which clue from the text best supports the answer to Part A?

A. "we will not be satisfied until 'justice rolls down like waters, and righteousness like a mighty stream.'" (Paragraph 13)

B. "And some of you have come from areas where your quest -- quest for freedom left

you battered by the storms of persecution" (Paragraph 14)

C. "go back to the slums and ghettos of our northern cities, knowing that somehow this situation can and will be changed." (Paragraph 14)

D. "Let us not wallow in the valley of despair, I say to you today, my friends." (Paragraph 15)


5. PART A: How does paragraph 4 contribute to the development of ideas in the text?

A. It emphasizes that African Americans have been cheated the civil rights that the nation owes them.

B. It demands that African American receive financial compensation for the injustices they have suffered.

C. It proves that African Americans are never going to stop fighting for their civil rights

and freedom.

D. It shows how essential African Americans' civil rights are to them by comparing rights to money.


6. PART B: Which quote from paragraph 4 best supports the answer to Part A?

A. "In a sense we've come to our nation's capital to cash a check."

B. "When the architects of our republic wrote the magnificent words of the Constitution and the Declaration of Independence, they were signing a promissory note"

C. "This note was a promise that all men, yes, black men as well as white men, would be guaranteed the 'unalienable Rights' of 'Life, Liberty and the pursuit of Happiness.'"

D. "Instead of honoring this sacred obligation, America has given the Negro people a bad check"


LETTER FROM MARY MALLON: ON BEING 'TYPHOID MARY'

Which of the following best describes the tone of Mary Mallon's letter?
A. resigned
B. frustrated
C. angry
D. saddened

2. Which of the following best states Mallon's purpose in writing this letter?
A. to report on her treatment to her lawyer
B. to inform her lawyer that she is firing him
C. to inform her lawyer that the doctors are not running any tests on her at all
D. to report on how cooperative she is being with the doctors and nurses

3. What does the word "enveigle" (or "inveigle") most closely mean, as used in paragraph 7?
A. to invite
B. to encourage
C. to persuade
D. to force

If answers for all of these questions are correct, I will mark you branliest

Answers

A. King believes that African Americans should not be denied their civil rights, and encourages others to be relentless in their non-violent fight for freedom.

B. "I have a dream that one day this nation will rise up and live out the true meaning of its creed: 'We hold these truths to be self-evident, that all men are created equal.'"

This quote from the text supports the central idea that King believes African Americans should not be denied their civil rights and should be treated equally. It also shows his determination to fight for this cause non-violently.


HOW DOES IT'S OPINION REGARDING HAPPINESS DIFFer From MeG'S
OPINION reGarDING HAPPINESS? EXPLAIN. WHO DO YOU agree WITH?
WHY?

Answers

* please make it more detailed! *

Happiness is a vague topic so you have to explain and describe that particular emotion to the audience

- through a hook

- explanation as such

Bronx Masquerade
What is the central idea of Tanisha’s poem “For the Record”?

Answers

The poem's main message is that Black women may resist efforts to silence and erase them by owning and sharing their memories. By doing so, they can build a society in which their experiences are respected and seen.

The  central idea of Tanisha’s poem “For the Record”?

Tanisha's poem "For the Record" is a personal reflection on the struggles of growing up as a Black girl in a society that often devalues and dismisses the experiences of Black women. The central idea of the poem is the importance of reclaiming and owning one's own story, and the power that comes from sharing one's experiences with others.

Throughout the poem, Tanisha describes the ways in which society has tried to erase and silence her voice, and the voices of other Black women. She talks about feeling invisible and unheard, and the frustration and pain that comes with being dismissed and ignored. However, she also celebrates the resilience and strength of Black women, and the power that comes from sharing their stories and experiences.

Ultimately, the central idea of the poem is that by owning and sharing their stories, Black women can push back against the forces that seek to silence and erase them, and create a world where their experiences are seen, heard, and valued.

Learn more on  central idea of Tanisha’s poem “For the Record” here: https://brainly.com/question/31007869

#SPJ1

Describe a scenario where a property owner might argue that his property has been taken from him by the local government because of a restriction that is put on the land now describe what the complaining public use of the restriction would be.mDescribe a scenario where a property owner might argue that his property has been taken from him by a local government because of a restriction that is put on the land now describe what the complaining public use of the restriction would be.

Answers

A government may compel someone to relocate in order to use the property for public infrastructure like interstates or roadways.

What steps does the government take when it comes to public property?

Eminent domain is the legal authority granted to the government to seize private property and make it available for public use, often known as a taking. According to the Fifth Amendment, the government may only use this authority provided it compensates the property owners fairly.

Can your property be taken by local government?

As long as you are appropriately compensated, governments are legally permitted to take your property for public use. Eminent domain is a legal doctrine that is applicable to federal, state, and local governments.

To know more about government visit:-

https://brainly.com/question/15709549

#SPJ1

*Note: The verbs are underlined. A Although ignored at first, Sara perseveres until critics recognized her talent. B. Although ignored at first, Sara persevered until critics recognized her talent C. Although critics ignore her, Sara perseveres until they recognized her talent. D. Although critics ignore her, Sara persevered until they recognize her talent. Which sentence on the left uses correct verb tense? A. Sentence C B. Sentence D C. Sentence B D. Sentence A​

Answers

Answer:

The correct sentence that uses the correct verb tense is B. Sentence D: "Although ignored at first, Sara persevered until critics recognized her talent." In this sentence, the past tense form of the verb "persevered" is used to match the past tense in "ignored" and "recognized."

Pls answer this question

Answers

Answer:

11. a

12. c

13. b

14. a

15. d

16. b

17. d

18. c

19. b

20. c

Explanation:

um most of thes you can just figure out by looking at them :)

Answer:

11- a. Connect
12- c. System

13- b. For

14- a. Along

15. d. Including

16- b. Keep

17- b. Outskirt

18- c. Debatable

19- a. Environment

20- c. Driverless

in which step of speech preparation do you research references for preparing a speech? question 26 options: a) compose b) think c) investigate d) rehearse

Answers

Answer: C) Investigate

Explanation: Plan your strategy, conduct your research, evaluate your sources

The correct answer is option C, "Investigate". In the step of speech preparation known as "investigate", you should research references for preparing a speech.

Researching references for preparing a speech is done in the “Investigate” stage of speech preparation. This step is important as it helps to ensure that the information you provide in your speech is accurate and relevant.To create a successful speech, you must plan and prepare your presentation carefully. A good speech has a clear message and is well-organized. Before delivering the speech, there are several steps you should follow: prepare, research, compose, and rehearse.You must investigate the subject in the preparation phase of your speech. The preparation stage entails conducting extensive research on the subject to gain a thorough understanding of it. As a result, you'll be able to identify the critical points that need to be addressed during the speech.You must learn about the subject matter as thoroughly as possible in order to generate an effective and intriguing speech. You must investigate the subject to do this. After you've gathered all of the information, you may move on to the composing stage, where you'll be tasked with composing your speech. The final step is rehearsing your speech to make certain you're delivering it correctly. Therefore, Option C is correct.

Learn more about speech: https://brainly.com/question/26157848

#SPJ11

In the girl next door by jack ketchum was Meg ever mean to Ruth and does it said it the book

Answers

Jack Ketchum's "The Girl Next Door" does not portray Meg as being cruel to Ruth. Ruth initially gets along with Meg and Susan when she moves in with their family.

How does Meg ever mean to Ruth?

Jack Ketchum's "The Girl Next Door" does not portray Meg as being cruel to Ruth. Ruth initially gets along with Meg and Susan when she moves in with their family. Meg and Susan's aunt, who is responsible for them, starts abusing Ruth physically and emotionally, and by doing nothing to stop it or report it to anyone, they become complicit in the abuse. Meg never actively takes part in Ruth's abuse, though it is clear that she is conflicted about the circumstances and her part in them. Meg is portrayed in the book as a victim of the abusive circumstance as well.

To Know more about "The Girl Next Door" Visit:

brainly.com/question/30753534

#SPJ1

when is it necessary for a rope to be taut?

Answers

Answer;



Explanation:

Identify the sentence in which an adverb clause is underlined.

Much of the desert has a scattered, indigenous population, which explorers sometimes encounter.
Although people live in the desert, they are still limited by its harsh climate.
Nomads continue to wander the desert in search of water and food.
Many animals are raised in captivity because the conditions are not as harsh.

Answers

The sentence that contains an adverb clause is "Although people live in the desert, they are still limited by its harsh climate."

What is an adverb clause?

A dependent clause that operates as an adverb in a sentence is known as an adverb clause. Adverb clauses can also modify adjectives or other adverbs in a sentence.  This is a good example of such a clause:

Before the storm hit, we went to the store to buy groceries.

In this sentence, "Before the storm hit" is an adverb clause modifying the verb "went." It tells us when the action took place.

From the given question, the adverb clause is "Although people live in the desert," which modifies the independent clause "they are still limited by its harsh climate." It provides additional information about the circumstances under which people are limited by the desert's harsh climate.

To find out more about adverb clauses, visit:

https://brainly.com/question/5870467

#SPJ9

Read the following implied thesis statement:

Legalizing recreational marijuana will not encourage teen-agers to use the drug.

Which choice below is the most effective supporting topic sentence for a paragraph in this essay?

Answers

"Studies have shown that teen marijuana use has not increased in states where recreational marijuana has been legalized."

What is the effect of smoking marijuana?

Smoking marijuana, also referred to as smoking cannabis, is the act of inhaling smoke made by smouldering the dried leaves, flowers, and stems of the cannabis plant. THC, or delta-9-tetrahydrocannabinol, is cannabis' primary psychoactive component and is what gives the drug its hallucinogenic properties. People use marijuana for a variety of reasons, such as for relaxation, euphoria, and altered reality perception while doing so recreationally. Its effects on pain relief, inflammation reduction, and anxiety reduction make it useful in medicine. Smoking marijuana, however, can also have detrimental effects on one's physical and mental health, such as memory loss, an accelerated heart rate, and respiratory issues. Different nations and jurisdictions have different laws governing marijuana use.

To Know more about Marijuana Visit:

brainly.com/question/13402559

#SPJ1

PLSSSS HELLPPP im going away and i don't have time to do this I really need help!!

Write an email cover letter to submit electronically for a job application. The job can be anything you choose (it doesn't have to be based on a real job listing), but it must be a specific position. For example, if the job is at a restaurant, you might apply to be a manager or a sous chef. Use full-block style for your email's formatting. You can base your letter on your own qualifications, or you can make up all the details you need.

Answers

Answer:

Explanation:

Dear [Hiring Manager],

I am writing to express my interest in the [Position] role at [Company]. I came across this opportunity on [Job Board/Company Website] and I am excited to apply for the position.

With my [Number] years of experience in [Related Field], I believe I am a great fit for the position. My skills and expertise in [Related Skills] will enable me to contribute to the growth and success of the company. In my current role as a [Current Position], I have developed [Related Achievements/Projects] that have positively impacted the organization. I am confident that my experience and skills will be valuable in this position.

In addition to my work experience, I have a [Degree/Certification] in [Field of Study] from [University/Institution]. My education and training have equipped me with [Related Knowledge/Skills] that will be useful in the position. I am also proficient in [Software/Tools] and I have excellent [Communication/Teamwork/Problem-Solving] skills.

I am excited about the opportunity to join the team at [Company] and contribute to the company's success. I look forward to discussing my qualifications and experience further in an interview. Thank you for considering my application.

Sincerely,

[Your Name]

In the book “Eragon” Chapters “Daret” through “On Reading and Plots”

What does Martin tell Brom and Eragon is the result in the city from the loss of ships at
sea?
(a) Town being deserted
(b) Marshal law
(c) High prices
(d) Little food

Answers

In the book "Eragon" chapters "Daret" through "On Reading and Plots," Martin tells Brom and Eragon that the result in the city from the loss of ships at sea is (c) high prices. This is because the city relies heavily on imported goods, and with the loss of the ships, the supply of goods has decreased, leading to an increase in prices. Martin explains that the situation has become so dire that even basic necessities like food have become too expensive for many people to afford.

Write three to four sentences explaining the differences between listening to a story, watching a story, and reading a story.

Answers

With students of all reading levels, listening can be used to help them develop these crucial language skills.

What distinguishes reading a story from seeing a story and listening to a story?

More Detail: The variations in the various media. When reading a written text, readers can compare what they "see" and "hear" to what they "hear" or "see" by listening to or watching an audio or visual version. The degree of audience participation required by each media is where there is the most variation.

How do you distinguish between storytelling and tale reading?

While reading aloud, a printed text is also present and spoken language is used. As a result, while reading a story, both written and oral language are simultaneously being modelled. On the other hand, presenting a story does not need a printed text to be present.

To know more about listening reading visit:

https://brainly.com/question/21830706

#SPJ1

HELPPPPPPPPPP 7
The United States receives more immigrants than any other nation in the world. However, many countries, like Saudi Arabia and Australia, have a greater percentage of their population made up of immigrants. What does this information reveal about these countries?

A.
They have smaller populations than that of the United States.

B.
Their life expectancy is less than in the United States.

C.
They have more lenient immigration policies than those in the United States.

D.
They encourage immigrants to move there more than the United States does.

Answers

The answer is C. Compared to the US, they have more lax immigration laws. These facts demonstrate that these nations welcome immigrants more readily than the United States.

They are more likely to welcome visitors and integrate them into society. These nations are actively working to diversify their populations and stand to gain from the economic and cultural contributions of immigrants. Also, it shows that some nations have developed economically more rapidly, which has drawn more immigrants to the nation. Also, it's possible that these nations have built an immigrant integration programme that is more effective, enabling immigrants to contribute positively to society.

To know more about immigrants refer to the link below :

https://brainly.com/question/27770592

#SPJ1

ENGLISH
Ava is checking her car insurance claim for grammar errors.
Select the two verbs that are not used correctly.

had my lights on as it was dark and raining hard. I pulled out of my parking space on
Commercial Road and drove up to the give way sign. I stopped there before pulling out
onto the ring road. There were at least two cars behind me. I stopped at the give way
sign and look around before starting to turn onto the ring road. As I began to pull out I
saw a cyclist. He was wearing dark clothes and didn't had any lights, so I didn't see him
until the last minute. As soon as I saw him, I braked. I was only going about 5 mph.

Answers

Answer:onto i think is  Into

Explanation:

 

The two verbs that are not used correctly in the passage are:

had - In the sentence "He was wearing dark clothes and didn't had any lights," the correct form should be "didn't have" instead of "didn't had." So, the correct sentence should be "He was wearing dark clothes and didn't have any lights."

look - In the sentence "I stopped at the give way sign and look around before starting to turn onto the ring road," the correct form should be "looked" instead of "look." So, the correct sentence should be "I stopped at the give way sign and looked around before starting to turn onto the ring road."

The corrected paragraph would then read:

"I had my lights on as it was dark and raining hard. I pulled out of my parking space on Commercial Road and drove up to the give way sign. I stopped there before pulling out onto the ring road. There were at least two cars behind me. I stopped at the give way sign and looked around before starting to turn onto the ring road. As I began to pull out, I saw a cyclist. He was wearing dark clothes and didn't have any lights, so I didn't see him until the last minute. As soon as I saw him, I braked. I was only going about 5 mph."

To learn more about verb here

https://brainly.com/question/28312327

#SPJ2

The Third Wish by Joan Aiken
1. In the setting, identify the season and the details that indicate the season.

Answers

The season in the setting is spring. The fact that points to the season is from the part where it was said that a man was driving in the dusk on spring.

What is meant by season?

In a general sense, a season is a division of the year marked by changes in weather, ecology, and hours of daylight. Seasons are usually characterized by distinct temperature, precipitation, and daylight patterns. The four seasons are commonly recognized as spring, summer, fall (autumn), and winter.

Different parts of the world may experience different seasons depending on their location and climate. In literature, seasons are often used to create a particular mood or atmosphere, and they may symbolize different themes or ideas.

Read more on seasons here:https://brainly.com/question/15734021

#SPJ1

One background information to support my claim that humans should be allowed to go to space

Answers

The exploration of space has led to numerous technological advancements in various fields such as medicine, telecommunications, and computing. For example, the development of satellite technology and the study of the effects of microgravity have led to improved medical imaging and treatment, as well as advancements in GPS technology. These technological advancements have not only benefited space exploration but also have practical applications on Earth. Thus, allowing humans to go to space can continue to drive technological progress and provide numerous benefits to humanity.

What is the overall theme of the poem america

Answers

Answer:

loving and hating the United States

Explanation:

'America' by Claude McKay balances ideas of loving and hating the United States. McKay explores the good parts of the country, the strength, and vigor it contains as well as the bad. Yet, he also comments on the 'bitterness', violence, and corruption the country is known for.

Tia and Lin had been best friends since kindergarten. Both

avid soccer players, the girls decided to try out for the high

school team together. Unfortunately, there was just one

open spot, so only one of the girls would be chosen. They

both worked hard, and on tryout day, they did their best.

When the team roster came out, Lin was excited to see

that she had made the team but sad that Tia had not. Tia

was happy for her friend and vowed to work harder so she

would make the team the next year.

Which sentence is part of the passage's rising action?

O

A. Both avid soccer players, the girls decided to try out for the high

school team together.

B. When the team roster came out, Lin was excited to see that she

had made the team but sad that Tia had not.

D C. Unfortunately, there was just one open spot, so only one of the

girls would be chosen.

D. Tia was happy for her friend and vowed to work harder so she

would make the team the next year.

Answers

Answer:

C

Explanation:

The rising action is a related series of incidents in a literary plot that builds, or leads, toward the point of greatest interest. Therefore, there only being one spot is leading up to the conflict.

How do many Afghans respond to the bacha posh?

Answers

Answer:

Explanation:

Bacha posh is a practice in which families without a son choose a daughter to dress and live as a boy until she reaches puberty. This practice has been documented in Afghanistan and other parts of the world. The response to bacha posh in Afghanistan is mixed and varies depending on the region and the family's cultural and religious background.

Some Afghans view bacha posh as a way to overcome the social and cultural limitations placed on women in Afghan society. They see it as a way to provide a daughter with greater freedom and opportunities to pursue education and work outside of the home. Other Afghans view bacha posh as a violation of traditional gender roles and social norms. They see it as a threat to the traditional family structure and an affront to Afghan culture and Islam.

Overall, the response to bacha posh in Afghanistan is complex and multifaceted. It is influenced by factors such as cultural, religious, and socioeconomic background, as well as individual beliefs and values.

Can anyone help me this is due tmr l only need help with ones that r not done

Answers

Answer:

7. B

8. A

9. D

10. B

Explanation:

7. Obtained means able to get, achieve means getting a desire or goal. So therefore it would be the best option for this question.

8. Getting a jolt is almost like getting a shock, it is a quick burst zap you feel in your body that may cause a quick reaction such as jumping up.

9. If the core is the yolk of the egg, then the crust must be the eggshell, because it encompasses the core. The other layers would represent the egg-whites.

10. Anyone who sets Achievable goals will always have the most success carrying them out and will never get frustruted. However, answer A might also be true in certain situations so reread the textbook for answer evidence.

Analyze how do Margie’s grade affect her feelings about school? Assess what other aspects of school might influence her feelings?

Answers

Because of her poor grades and increased dislike of school due to the workload, Margie's attitudes about school are affected. anything with potential.

What did Margie detest most about her school?

The part Margie hated the most was the slot where she had to insert her homework and test papers. She figured ancient schools must have been fun because students used to sit together in class.

Why does Margie despise school so much more?

Margie detested going to school, which took place in a room in her home, only because her instructor was a robot. It kept offering her test papers that required punch code responses. Instantaneous findings were provided.

To know more about Margie’s grade visit:-

https://brainly.com/question/26399182

#SPJ1

Other Questions
L: 40 inThe figure will be dilated by a Dscale factor of 3.5. Find thenew measure of the base.9 in10 in9 in hie, is the anyone who have done or write the short story HOME tm by Eckard Smuts Bank account application Requirement Please write a Java application for managing a bank account as follow: A bank account must have following fields: Account type: saving or checking Account number: 6 character long (alphanumeric) Account's creation date (String) Customer's first name Customer's last name Customer's date of birth (String) Customer's last 4 digit of social security number . Customer's address (address1, address2, city, state, zipcode) Field validations Account type must be either "saving" or "checking". Account number must be 6 character long (alphanumeric). Creation date must be a non-empty string. Customer's first name, last name, and date of birth must be a non-empty string. Customer's last 4 digit of SSN must be exactly 4 digits. Address1, City, State and Zipcode must be non-empty string. NOTE: If any of the above validations failed, the user should be prompted by an appropriate error message and another chance to enter a proper data. Final Step The application should ask end user to enter all the information above and then it must display all information except last 4 digit since it is a sensitive information. Then the user should enter last 4 digit to verify it. This verification can happen up to 3 times, then the user will be prompted by failure or successful message accordingly. A rib fracture can be caused by a direct blow, a violent cough, and/or sneeze The figure (Figure 1) shows the reaction of element A (lavender spheres) with element B (tan spheres). Write the balanced chemical equation for this reaction in terms of A and B .Express your answer as a chemical equation. Describe the end behavior of each function.1. f(x) = -x + 2x -x+4 2. f(x)= x -x -x -1Asking for help please, Thank you A printer company has two locations with a total of 23 employees. If four times the number of employees at the larger location is four greater than seven times the number of employees at the smaller location, how many employees are at each location?a. 8b. 10c. 14d. 16 How does a lawmaker's political affiliation impact his or her vote? Why does this occur? Please help!Questions below! A quadrilateral has two angles that measure 216 and 102. The other two angles are in a ratio of 10:11. What are the measures of those two angles? 2. Determina el esfuerzo en un resorte con un mdulo de Young equivalente a 300 Pascales, si su deformacin es de 30. Alguien me ayuda urgente 15 POINTS. How to do this one please teach by step by step Need help with this I have to study Find the Z-scores for which 50% of the distribution's area lies between -z and z. Click to view page 1 of the table Click to view page 2 of the table. The z-scores are(Use a comma to separate answers as needed Round to two decimal places as needed. ) Case Study B (1500 words) Industry Category: Automobile Manufacturing Company Name: 123 Automobile Location: Abu Dhabi - UAE Go through the case study and answer the questions that follow. In 2018 a new automobile Manufacturing was established in Abu Dhabi UAE, making electrical vehicles (EV). The organization aims to have competitive advantages in relation to the cost, battery operation time, vehicle lifespan, and overall quality to suit the GCC conditions (eg: weather). The company has a strong leadership team and are implementing top leadership strategies. However, the KPIs are not being met and the BOD are not satisfied with the results, especially because of COVID-19. A massive production loss occurred during this period. The company relies heavily on human labor to manufacture the EV, having some of the most talented individuals from the GCC region. Statistics 1,850 Employees 5,723 EV manufactured in 2022 6,750 EV KPI in 2022 8,500 EV KPI in 2023 $1.7m Profits (actual) in 2022 financials $2.5m Profits (KPI) in 2022 $4.3m Profits (KPI) in 2023 Questions: 1. Is the concept of TQM clear throughout the organization? 2. What are the changes required for TQM Culture adoption in this organization? 3. Highlight the contribution of QC to improve quality in a department/function when organizations strive to realize organizational goals and objectives. 4. Do you feel TQM will help in Short Term and/or Long-Term Success? Give your own understanding. 5. How would you implement Kanban system for ABC Pharmaceutical? Give specific examples. 6. How would you implement Kaizen system for ABC Pharmaceutical? Give specific examples infer the consequence for evolution if speices did not vary (1 point) Assume that the monthly wondwide average number of airplaine crashes of commercial ailines is \( 2.2 \). What is the probability that there wili be (a) at most 3 such accidents in the next m Carlos is creating a 3D newspaper. He wants the text to be readable, but currently the lines are so close together that the bottoms of some letters (like y and p) touch the tops of some capital letters on the following line. What should he adjust to fix this problem?Question 11 options:formattingtrackingtypefacingleading ............................. 1. There are three buses A, B and C. the totalnumber of seats in the three buses is 250. 28% ofthe 250 seat are in bus A.number of seats in bus B:number of seats in busC = 3:238 of the seats in bus B are empty. 26 in bus Care empty.Jamie says the percentage of the seats in bus Bthat are empty is greater than the percentage ofthe seats in bus C that are empty. Is Jamiecorrect.