What is the total amount due on 20000 which has been invested for five years at 10% annual interest?

Answers

Answer 1

Therefore , the solution of the given problem of amount comes out to be 30000 is the new amount.

What is an amount?

aggregate attempting to determine the length of time needed, overall amount or quantity. The amount in front of you or being thought about is very active. the final outcome, its significance, or its meaning. three accountings: principal, interest, and the third. Word versions include amounts, amounting, and amounted. supple word How much something is, how often you possess

Here,

The straightforward interest formula can be used to determine the total amount owing on $20,000 that has been invested for five years at 10% annual interest:

=> Sum total = Principal + Interest

where Principal represents the amount invested initially and Interest represents the interest collected over the course of five years.

Since the interest gained annually is 10% of the principal, the total interest earned over the course of five years is as follows:

=> Interest is calculated as follows:

=> Interest = P*R*T

=> Interest = 20000 * 0.10 * 5

=> Interest = 10000

Total amount = 20000 +10000 = 30000

To know more about amount visit :-

brainly.com/question/8082054

#SPJ1


Related Questions

Can someone please explain to me what is the Principal of Inclusion-Exclusion and what it looks like for n different sets? Much love to those who can help :)

Answers

The size of the union of sets is determined using the Principle of Inclusion-Exclusion (PIE).

What is inclusion-exclusion principle?

The inclusion-exclusion principle is a counting method that generalises the well-known approach to determining the number of members in the union of two finite sets in the field of combinatorics.

The Principle of Inclusion-Exclusion (PIE) is a counting technique used to find the size of a union of sets.

It is often used when counting the number of elements that belong to one or more sets.

For a simple example, consider two sets A and B.

The size of their union (i.e., the number of elements that belong to A or B, or both) can be found using the formula -

|A ∪ B| = |A| + |B| - |A ∩ B|

Here, |A| represents the size of set A, |B| represents the size of set B, and |A ∩ B| represents the size of the intersection of A and B (i.e., the number of elements that belong to both A and B).

The formula says that to find the size of the union of A and B, we add the sizes of A and B, but then we need to subtract the size of the intersection of A and B, because we have counted those elements twice.

The Principle of Inclusion-Exclusion can be extended to n different sets, as follows -

|A₁ ∪ A₂ ∪ ... ∪ Aₙ| = ∑|Aᵢ| - ∑|Aᵢ ∩ Aⱼ| + ∑|Aᵢ ∩ Aⱼ ∩ Aₖ| - ... + (-1)ⁿ₋¹|A₁ ∩ A₂ ∩ ... ∩ Aₙ|

Here, the notation ∑ represents a sum, and the notation (-1)ⁿ₋¹ represents (-1) to the power of n-1.

The formula says that to find the size of the union of n different sets, we add up the sizes of all the individual sets, then subtract the sizes of all possible intersections of two sets, then add the sizes of all possible intersections of three sets, and so on, alternating between addition and subtraction, until we add or subtract the size of the intersection of all n sets, depending on whether n is even or odd.

Therefore, the PIE is defined and described for n different sets.

This formula can be used to count the number of elements in the union of any number of sets, but it can get quite complex for large values of n.

To learn more about inclusion-exclusion principle from the given link

https://brainly.com/question/29586729

#SPJ1

A boat heading out to sea starts out at Point A, at a horizontal distance of 1035 feet from a lighthouse/the shore. From that point, the boat’s crew measures the angle of elevation to the lighthouse’s beacon-light from that point to be 8 degrees At some later time, the crew measures the angle of elevation from point B to be 5 degrees . Find the distance from point A to point B. Round your answer to the nearest foot if necessary.

Answers

Answer: Let's assume that the distance between the lighthouse and point B is x. Then, we can use the tangent function to set up an equation involving the angles of elevation:

tan(8°) = (height of lighthouse) / (distance from A to lighthouse)

tan(5°) = (height of lighthouse) / x

Since the height of the lighthouse is the same in both equations, we can set them equal to each other:

tan(8°) = tan(5°) * (distance from A to lighthouse) / x

Solving for x:

x = (tan(5°) * 1035) / tan(8°)

x ≈ 14416

So the distance from point A to point B is approximately 14,416 feet.

Step-by-step explanation:

In a voter survey (February 2022), the Center Party had 5.2% sympathizers out of 1972 people interviewed. In a corresponding survey in January 2022, 6.0% of 2189 interviewees sympathized with the Center Party.
Form a 95% confidence interval for the difference in the proportion of Center Party members at the two survey times.
Answer only with the statistical margin of error and enter this as a number between 0 and 1 to 3 correct decimal places.

Answers

0.0247

To form a 95% confidence interval for the difference in the proportion of Center Party members at the two survey times, one needs to use the following formula: CI = (p1 - p2) ± z (SE), where p1 and p2 are the sample proportions for February 2022 and January 2022, respectively. To calculate the standard error (SE), use the following formula: SE = √ [(p1 (1-p1))/n1 + (p2 (1-p2))/n2], where n1 and n2 are the sample sizes for February 2022 and January 2022, respectively.The statistical margin of error is the term used to describe the range of error that is expected for a statistical estimate or survey. This range of error is expressed as a percentage of the estimate or survey result, and it is typically denoted as a plus or minus sign before the percentage value. Thus, the statistical margin of error can be calculated by taking the product of the standard error and the z-score corresponding to the desired level of confidence. In this case, the level of confidence is 95%, and the corresponding z-score is 1.96. Therefore, the formula for the margin of error is: ME = z × SE, where z = 1.96. So, let's now calculate the confidence interval for the difference in the proportion of Center Party members at the two survey times.CI = (p1 - p2) ± z (SE)CI = (0.052 - 0.06) ± 1.96 (SE)SE = √ [(p1 (1-p1))/n1 + (p2 (1-p2))/n2]SE = √ [(0.052 (1-0.052))/1972 + (0.06 (1-0.06))/2189]SE = 0.0126ME = z × SE = 1.96 × 0.0126ME = 0.0247Therefore, the 95% confidence interval for the difference in the proportion of Center Party members at the two survey times is (-0.057, -0.029), and the statistical margin of error is 0.0247 (rounded to 4 decimal places).Answer: 0.0247

Learn more about Confidence interval

brainly.com/question/24131141

#SPJ4

The arm span and foot length were measured (in
centimeters) for each of the 19 students in a statistics
class. The results are displayed in the scatterplot.
Arm Span vs. Foot Length
Foot Length (cm)
29
27
23
21


19
155 160 165 170 175 180 185 190 195
Arm Span (cm)
The equation ý = -7.61 +0.19x is called the least-
squares regression line because it
O passes through each data point.
Ominimizes the sum of the squared residuals.
Omaximizes the sum of the squared residuals.
O is least able to make accurate predictions for the
data.

Answers

Answer: The correct answer is:

The equation ý = -7.61 +0.19x is called the least-squares regression line because it minimizes the sum of the squared residuals.

Explanation:

The least-squares regression line is a line that represents the best linear approximation of the relationship between two variables. It is called "least-squares" because it minimizes the sum of the squared residuals, which are the differences between the observed values and the predicted values from the regression line.

In this case, the scatterplot shows the relationship between arm span and foot length for 19 students in a statistics class. The equation ý = -7.61 +0.19x is the equation of the least-squares regression line for this data set. This means that it is the line that best fits the data by minimizing the sum of the squared residuals.

Therefore, the correct answer is that the equation ý = -7.61 +0.19x is called the least-squares regression line because it minimizes the sum of the squared residuals.

Step-by-step explanation:

You are rolling two dice. Find the probability of rolling two fives.

A. 1/6
B. 1/36
C. 1/18
D. 1/24​

Answers

The probability of rolling a five on one die is 1/6, since there are six equally likely outcomes (numbers 1 through 6) and only one of them is a five.

Since we are rolling two dice, the probability of rolling two fives is the product of the probability of rolling a five on each die, which is:

(1/6) x (1/6) = 1/36

Therefore, the answer is B: 1/36.

Answer:

B. 1/36

Step-by-step explanation:

A dice has 6 sides, we are looking to roll a 5, which is just one number, hence 1/6. If you roll two, to find the probability of two independent events (meaning they do not affect each other), you multiply the two together.

1/6 x 1/6 = 1/36

Solve each system equation by substitution. Check the solution.

Answers

The evaluation of the questions in the parts using substitution method, can be presented as follows;

9. First part; The mistake is the assumption that there are no solution; The equation have an infinite number of solutions

Second part; The main difference between solving a system of equations by graphing and solving by substitution is that graphing involves visualizing the equations, while substitution involves algebraic manipulation.

Solving by graphing can be useful to find a quick estimate of the solution of the equation system, while substitution is useful for finding the exact solution to the equations.

Third part; The dimensions are;

Length, L = 11.8 feet

Width, W = 7.2 feet

Fourth part; Zaid made 4 two-points basket, and 3 three-point baskets in the game.

What is the substitution method?

The substitution method used for solving a system of equations involves solving one of the equations for one of the variables, and then substituting the expressions obtained into the other equation.

First part;

The first problem can be expressed as follows;

x + y = 7

2·x + 3·y = 17

The substitution method can be used to find the solution to the above system of equations as follows;

x = 7 - y

The above expression for the variable x can be substituted in the second equation as follows;

2·(7 - y) + 3·y = 17

Therefore; 14 - 2·y + 3·y = 17

The combination like terms, indicates;

y = 17 - 14 = 3

y = 3

Therefore; x + 3 = 7

x = 7 - 3 = 4

x = 4

Therefore, Zaid made 4 two-point baskets and 3 three-point baskets in the game

Therefore, the number of two-point basket Zaid made are 4, and the number of three-point basket he made in the game are 3

Second part;

The system of equations in the situation is presented as follows;

L = W + 4.6

2·L + 2·W = 38

The substitution of the variables can be used to solve the system of equations as follows;

2·(W + 4.6) + 2·W = 38

Simplifying the above equation, we get;

4·W + 9.2 = 38

Therefore; W = (38 - 9.2)/4 = 28.8/4 = 7.2

W = 7.2

Substituting the value of W in the above equation for L, we get;

L = 7.2 + 4.6 = 11.8

L = 11.8

The dimensions of the rectangle are therefore;

Length, L = 11.8 feet

Width, W = 7.2 feet

Third Part;

Solving a system of equations by graphing involves graphing the equations on the same coordinate plane and finding the point of intersection of the two lines. The point of intersection represents the solution to the system of equations.

Solving a system of equations by substitution involves solving one of the equations for one of the variables in terms of the variable, and then substituting this expression into the other equation. This results in an equation with only one variable, which can be solved to find the value of the variable. Once one variable is found, the other variable can be found by substituting the value of the value of the first variable into one of the original equations.

Fourth part;

The equations; y = x - 1, and y - x = -1 are the same equation, therefore, the equations have infinite number of solutions

Therefore;

The mistake is that statement that the equation has no solutions

Learn more on the solving a system of equations here: https://brainly.com/question/10724274

#SPJ1


How is the graph of the square root parent function, f(x)=√x₁
transformed to generate g(x)=√√2 (x+6) — 2?

Answers

A new graph is produced from parent function, which is horizontally moved 6 units to the left, extended vertically, and shifted 2 units downward.

A parent function is what?

By performing numerous transformations, including shifts, stretches, and reflections, a parent function is a fundamental function that serves as the foundation for the creation of subsequent functions. Since they have straightforward, well-known qualities and are simple to alter to produce new functions, parent functions are frequently used. Linear, quadratic, cubic, square-root, absolute value, and exponential functions are a few examples of typical parent functions. Each parent function has a unique structure and set of characteristics that may be used to forecast how the function will behave after being changed.

The following procedures can be used to change the graph of the square root parent function, f(x) = x, to produce g(x) = 2 (x + 6) - 2.

Shift to the left by 6 units along the horizontal axis: The square root function's expression (x + 6) causes this shift.

Stretching the graph vertically is accomplished by multiplying the square root function by a factor of two.

Vertical shift: Next, a 2-unit downward shift is applied to the entire function.

A new graph is produced as a result of these modifications, which is horizontally moved 6 units to the left, extended vertically, and shifted 2 units downward.

Learn more about parent function here:

https://brainly.com/question/17939507

#SPJ1

Please help me I want to finish this so I can get the full grade

Answers

The population density of the town is 13,000 people per square mile.

How to calculate population density in an area?

To calculate the population density in an area, you need two pieces of information: the total population of the area and the total land area of the area. Population density calculation refers to the process of determining the number of individuals living in a particular area, expressed as a ratio or proportion of the size of that area.

[tex]Population Density =\frac{Total Population }{Total Land Area}[/tex]

According to the question the total land area of the town can be calculated as follows:

Total Land Area = 20 blocks x ([tex]\frac{1}{20}[/tex] mile) x ([tex]\frac{1}{2}[/tex] mile) = 0.5 miles²

We are also given that there are 6,500 people in the town. Therefore, the population density can be calculated as follows:

[tex]Population Density =\frac{6,500}{0.5}[/tex] = 13,000 people per square miles.

Therefore, the population density of the town is 13,000 people per square mile.

To know more about density, visit:

https://brainly.com/question/1354972

#SPJ1

Which term gives the horizontal length of one cycle of a periodic function?
amplitude
period
frequency
phase shift

Answers

Period gives the horizontal length of one cycle of a periodic function as [tex]2\pi[/tex].

Given that,

To determine which term gives the horizontal length of one cycle of a periodic function.

What are functions?

Functions is the relationship between sets of values. e g y=f(x), for every value of x there is its exists in a set of y. x is the independent variable while Y is the dependent variable.

Here,

In the periodic function 1 period is consist of 2π on the horizontal axis, so, the period represents the horizontal length of the periodic function.

Thus, Period gives the horizontal length of one cycle of a periodic function as 2π.

learn more about function here:

https://brainly.com/question/21145944

Out of 700 employees of a firm 340 have a life insurance policy ,280 have a medical insurance cover and
150 participate in both programmes
i ) What is the probability that a randomly selected employee will be a participant in atleast one of the two programmes?
ii ) Determine the probability that an employee will be a participant in the life insurance plan given that he/she has a medical insurance coverage
iii) Determine the probability that one has none of the two insurance covers

Answers

(i). The required probability is approximately 0.486 or 48.6%.

(ii) The required probability is approximately 0.536 or 53.6%.

(iii) The required probability is approximately 0.329 or 32.9%.

Given:

Total employees (n) = 700

Employees with a life insurance policy (A) = 340

Employees with a medical insurance cover (B) = 280

Employees who participate in both programs (A ∩ B) = 150

i) To find the probability that a randomly selected employee will be a participant in at least one of the two programs (A or B), we need to calculate P(A ∪ B).

Using the inclusion-exclusion principle:

P(A ∪ B) = P(A) + P(B) - P(A ∩ B)

P(A ∪ B) = (340/700) + (280/700) - (150/700)

P(A ∪ B) = 0.671

Therefore, the probability that a randomly selected employee will be a participant in at least one of the two programs is approximately 0.486 or 48.6%.

ii) To determine the probability that an employee will be a participant in the life insurance plan given that he/she has medical insurance coverage, we need to find P(A | B).

Using the formula for conditional probability:

P(A | B) = P(A ∩ B) / P(B)

P(A | B) = (150/700) / (280/700)

P(A | B) = 0.536

Therefore, the probability that an employee will be a participant in the life insurance plan given that he/she has medical insurance coverage is approximately 0.536 or 53.6%.

iii) To determine the probability that one has none of the two insurance covers, we need to find the complement of P(A ∪ B), which is the probability of not being a participant in either program.

P(neither A nor B) = 1 - P(A ∪ B)

P(neither A nor B) = 1 - 0.671

P(neither A nor B) = 0.329

Therefore, the probability that an employee has none of the two insurance covers is approximately 0.329 or 32.9%.

To learn more about the probability;

brainly.com/question/11234923

#SPJ12

Please answer the questions below

Answers

Step-by-step explanation:

First one

5,5√5,25

Second one

-3,12,-48

Use properties to rewrite the given equation. Which equations have the same solution as 2.3p – 10.1 = 6.5p – 4 – 0.01p? Select two options. 2.3p – 10.1 = 6.4p – 4 2.3p – 10.1 = 6.49p – 4 230p – 1010 = 650p – 400 – p 23p – 101 = 65p – 40 – p 2.3p – 14.1 = 6.4p – 4

Answers

Therefore, the equations that have the same solution as 2.3p – 10.1 = 6.5p – 4 – 0.01p are: 2.3p – 10.1 = 6.4p – 4 and 23p – 101 = 65p – 40 – p.

What is equation?

In mathematics, an equation is a statement that two expressions are equal. It typically contains one or more variables (unknowns) and specifies a relationship between those variables. Equations are used to model real-world phenomena, solve problems, and make predictions. There are many types of equations in mathematics, including linear equations, quadratic equations, polynomial equations, exponential equations, trigonometric equations, and many more. Each type of equation has its own set of methods and techniques for solving it.

Here,

To rewrite the given equation using properties, we can simplify both sides by combining like terms and then isolate the variable term on one side of the equation:

2.3p – 10.1 = 6.5p – 4 – 0.01p

2.3p - 6.5p + 0.01p = -4 + 10.1

-4.19p = 6.1

p = -6.1/4.19

To check which equations have the same solution, we can substitute this value of p into each equation and see if both sides are equal:

2.3p – 10.1 = 6.4p – 4

2.3(-6.1/4.19) - 10.1 = 6.4(-6.1/4.19) - 4

-9.84 = -9.84

This equation has the same solution as the original equation.

23p – 101 = 65p – 40 – p

23(-6.1/4.19) - 101 = 65(-6.1/4.19) - (-6.1/4.19)

-63.64 = -63.64

This equation also has the same solution as the original equation.

To know more about equation,

https://brainly.com/question/2228446

#SPJ1

Then lengths of the sides of a square are 9 meters. Find the length of the of the diagonal of the square.

? square root of ?

Answers

Answer:

12.73 meters

Step-by-step explanation:

Let d be the length of the diagonal, and let s be the length of each side of the square. Then, we have:

d^2 = s^2 + s^2 (by the Pythagorean theorem)

d^2 = 2s^2

d = sqrt(2s^2) = sqrt(2) * s

Substituting s = 9 meters, we get:

d = sqrt(2) * s = sqrt(2) * 9 meters

d ≈ 12.73 meters

Therefore, the length of the diagonal of the square is approximately 12.73 meters

(Find the LCM of): (a - b)² + 4ab, (a + b)³ - 3ab(a+b) ,a² + 2ab + b²​

Answers

Answer:

[tex](a+b)^2(a^2-ab+b^2)[/tex]

The 3 lines x = 3, y – 2. 5 =-(x – 0. 5), and y – 2,5 = x – 3. 5 intersect at point P.

Find the coordinates of P. Verify algebraically that the lines all intersect at P.

Answers

All three equations are satisfied when x = 3 and y = 2, which means that the lines intersect at the point (3, 2).

To find the coordinates of point P where the three lines intersect, we need to solve the system of equations formed by the three lines:

x = 3 (equation 1)

y - 2.5 = -(x - 0.5) (equation 2)

y - 2.5 = x - 3.5 (equation 3)

From equation 1, we know that x = 3. substituting this into equations 2 and 3, we get:

y - 2.5 = -2.5 (from equation 2)

y - 2.5 = -0.5 (from equation 3)

Simplifying these equations, we get:

y = 0 (from equation 2)

y = 2 (from equation 3)

So the coordinates of point P are (3, 2).

To verify that the lines all intersect at this point, we can substitute these coordinates into each of the original equations and check that they hold:

For equation 1: x = 3 holds when x = 3.

For equation 2: y - 2.5 = -(x - 0.5) becomes y - 2.5 = -(3 - 0.5) = -2 holds when x = 3 and y = 2.

For equation 3: y - 2.5 = x - 3.5 becomes y - 2.5 = 3 - 3.5 = -0.5 holds when x = 3 and y = 2.

So all three equations are satisfied when x = 3 and y = 2, which means that the lines intersect at the point (3, 2).

To know more about intersect click here:

brainly.com/question/18473713

#SPJ4

4.02 Lesson Check Arithmetic Sequences (5)

Answers

The explicit formula of each arithmetic sequence is given as follows:

35, 32, 29, 26, ...: [tex]a_n = -3n + 38[/tex].-3, -23, -43, -63, ...: [tex]a_n = -20n + 17[/tex]9, 14, 19, 24, ...: [tex]a_n = 4 + 5n[/tex]7, 9, 11, 13, ...: [tex]a_n = 5 + 2n[/tex]

What is an arithmetic sequence?

An arithmetic sequence is a sequence of values in which the difference between consecutive terms is constant and is called common difference d.

The nth term of an arithmetic sequence is given by the explicit formula presented as follows:

[tex]a_n = a_1 + (n - 1)d[/tex]

[tex]a_1[/tex] is the first term of the arithmetic sequence.

For each sequence in this problem, the first term and the common difference are obtained, then substituted into the equation, which is simplified.

More can be learned about arithmetic sequences at https://brainly.com/question/6561461

#SPJ1

(5x-2y)(a-b)-(2x-y)(a-b)

Answers

Answer:

First, let's simplify the expression by combining like terms:

(5x-2y)(a-b) - (2x-y)(a-b)

= (5x-2y-2x+y)(a-b) // Distribute the (a-b) to each term

= (3x-y)(a-b)

Therefore, (5x-2y)(a-b) - (2x-y)(a-b) simplifies to (3x-y)(a-b).

The goal of this research is to evaluate the expression (5x-2y)(a-b)-(2x-y)(a-b). First, it is important to review the basic principles of algebra and the technical definitions of expressions and powers. This involves a recap of addition, subtraction, multiplication, and division of algebraic expressions.

Next, the expression under analysis needs to be broken down into the terms and factors. To achieve this, parentheses and binsomials need to be grouped and identified. This is a critical step in the evaluation process of the expression.

After this has been done, the algebraic steps for simplifying the expression need to be taken. This involves applying the commutative, associative, distributive and other relevant laws of algebra to achieve an answer in the simplest way. It is important to remember that each step needs to be documented and the source of the information should be clearly indicated.

In terms of sources, it is important to only select reliable websites, textbooks and journals approved by experts in the field. Examples of these are the American Mathematical Society, the Johns Hopkins University, and the Massachusetts Institute of Technology.

Finally, the expression needs to be scrutinized to ensure that all steps have been taken correctly and the outcome is what was expected. Once this has been completed, the answer can be documented and the paper/article can be published.

In conclusion, the expression (5x-2y)(a-b)-(2x-y)(a-b) can be evaluated through an organized approach involving the use of the fundamental principles of algebra and reliable sources for validating the findings.

Answer:

(a-b) (3x - y)

Step by step explanation:

First, we can simplify the expression by factoring out the common factor of (a-b):

(5x-2y)(a-b)-(2x-y)(a-b) = (a-b) [(5x-2y) - (2x-y)]

Expanding the brackets, we get:

(5x-2y) - (2x-y) = 5x - 2y - 2x + y = 3x - y

Substituting this back into the simplified expression, we get:

(5x-2y)(a-b)-(2x-y)(a-b) = (a-b) (3x - y)

Therefore, the final simplified expression is:

(a-b) (3x - y)

1. If we are only interested in one side of the curve, a p = 0.05 has a z-score of ___.
2. The population standard deviation is the square root of the population variance.
True
False
3. If we are interested in both sides of the curve, a p = 0.05 has a z-score of ___.
4. If an IQ score is in the lower 5%, what is the equivalent z-score?
-1.96
-1.64
-2.58
2.58

Answers

According to the given information, a significance level is of 0.05, the population standard deviation is the square root of the population variance is true, the critical z-score is 1.96, z-score is -1.64.

What is the mean and standard deviation?

The mean, also known as the average, is the sum of all the values in the data set divided by the number of values. The standard deviation measures the amount of variability or dispersion in the data set.

1) When we are only interested in one side of the curve, we use a one-tailed test with a significance level of 0.05. For a one-tailed test with a significance level of 0.05, the critical z-score is 1.645 for a right-tailed test and -1.645 for a left-tailed test.

2) The population standard deviation is the square root of the population variance: True. The population standard deviation is the square root of the population variance. The formula for population variance is:

[tex]$\sigma^2 = \frac{\sum_{i=1}^N (x_i - \mu)^2}{N}$[/tex]

where [tex]$\sigma^2$[/tex] is the population variance, [tex]$\mu$[/tex] is the population mean, [tex]$x_i$[/tex] are the individual values in the population, and [tex]$N$[/tex] is the size of the population. The formula for population standard deviation is:

[tex]$\sigma = \sqrt{\sigma^2}$[/tex]

3) When we are interested in both sides of the curve, we use a two-tailed test with a significance level of 0.05. For a two-tailed test with a significance level of 0.05, the critical z-score is 1.96.

4) To find the z-score for an IQ score in the lower 5%, we need to find the z-score that corresponds to a cumulative probability of 0.05. Using a standard normal distribution table, we find that the z-score for a cumulative probability of 0.05 is approximately -1.64. Therefore, an IQ score in the lower 5% corresponds to a z-score of approximately -1.64.

To know more about mean and deviations visit:

brainly.com/question/14720855

#SPJ1

5 circles lie on a plane what is the maximum number of intersection points

Answers

The maximum number of intersection points between 5 circles on a plane is 20.

To see why, we can use a formula that calculates the maximum number of intersection points between n circles on a plane. This formula is:

N = n(n-1)/2

For n=5, we have:

N = 5(5-1)/2

N = 5(4)/2

N = 10

So there are a total of 10 intersection points between the 5 circles. However, we have to remember that not all of these intersection points may be distinct. For example, three circles intersecting at the same point will count as three intersections, but only as one distinct intersection point.

Therefore, we need to count how many of these 10 intersection points are distinct. With a bit of visualization, we can see that each circle can intersect with the other four circles in two different points, for a total of 8 distinct intersection points per circle. Since we have 5 circles, we multiply 8 by 5 to get:

8 x 5 = 40

However, we have overcounted, since any intersection point shared by three circles counts as three, but only as one distinct intersection point. There are exactly 10 such triple intersections, as we can see by drawing the five circles such that each circle intersects with the other two. So we need to subtract 20 (since each of the 10 triple intersections counts as 3, not 1).

Therefore, the maximum number of distinct intersection points between 5 circles on a plane is:

40 - 20 = 20

So the answer is 20.

To know more about intersection click here:

brainly.com/question/14217061

#SPJ4

please help with all three !!!!

Answers

Answer:  

1. A'(3,2),  B'(1,7), C'(-6,1)

Step-by-step explanation:

I only know 1. because you are reflecting from the y-axis so that being said

A' - intend of moving it to the left 3 you will move it to the right 3 and move up 2.

B' - intend of moving it to the left 1 you will move it to the right 1 and move up 7.

C' - intend of moving it to the right 6 you will move it to the left -6 and move up 1.

and were is the reflecting line happing at with Qs, 2 and 3.

Find the area under the standard normal curve to the left of z =-2.77 and to the right of z--2.22. Round your answer to four decimal places. if necessary. Answer Tables Keypad If you would like to look up the value in a table, select the table you want to view, then either click the cell at the intersection of the row and column or use the arrow keys to find the appropriate cell in the table and select it using the Space key Normal Table-" to-z Normal Table-a to z

Answers

The area under the standard normal curve to the left of z=-2.77 and to the right of z=-2.22 is 0.0167-0.0033 = 0.0134. This answer is rounded to four decimal places, so the answer is 0.0134.

What is area?

Area is a two-dimensional measurement, defined as the amount of two-dimensional space taken up by a shape or object. It is measured in units such as square meters, square kilometers, or square feet.

The area under the standard normal curve to the left of z=-2.77 and to the right of z=-2.22 can be calculated using the normal tables. The normal table shows the area under the standard normal curve from 0 up to the given z-value. Using the normal table, the area to the left of z=-2.77 is 0.0033 and the area to the right of z=-2.22 is 0.0167.

The normal table is a useful tool for calculating the area under the standard normal curve for different z-values. The table is organized such that the row headers are the z-values and the column headers are the area under the curve from 0 up to the given z-value. By looking up the z-values in the table, we can calculate the area under the standard normal curve for any given area. This makes it easy to calculate the area under the standard normal curve for any given set of z-values.

Using a standard normal table, the area to the left of z = -2.77 is 0.0028 (rounded to four decimal places), and the area to the right of z = -2.22 is 0.0139 (rounded to four decimal places).

Therefore, the area under the standard normal curve to the left of z = -2.77 and to the right of z = -2.22 is:

0.0028 + 0.0139 = 0.0167 (rounded to four decimal places)

For more questions related to values

brainly.com/question/843074

#SPJ1

If 300 people donated blood in Springfield, about how many were AB+?

Answers

Number of people with AB+ blood type = 3.4 / 100 x 300 .Number of people with AB+ blood type = 10.Therefore, of the 300 people who donated blood, approximately 10 people would have been AB+.

Assuming the distribution of blood types in Springfield are the same as the distribution in the US, then the percent of AB+ blood type donors would be 3.4%. Therefore, of the 300 people who donated blood, approximately 10 people would have been AB+. This calculation is based on the following formula: Percent of AB+ blood type donors = Number of people with AB+ blood type / Total number of people who donated Number of people with AB+ blood type = Percent of AB+ blood type donors / 100 x Total number of people who donated Number of people with AB+ blood type = 3.4 / 100 x 300 .Number of people with AB+ blood type = 10.

Learn more about Number here:

https://brainly.com/question/28210925

#SPJ4

from the top of a building, a man observes a car moving toward him. as the car moves 100 ft closer, the angle of depression changes from 15 to 33 o o . find the height of the building.

Answers

When a man on top of a building sees a car approaching him and as the car moves 100 ft closer, the angle of depression changes from 15 to 33 degrees, the height of the building is 159.8 feet.

To solve the problem, we can use the tangent function. Let x be the distance between the man and the building, then we have:

tan(15) = h / x ...........(1) and tan(33) = h / (x - 100) ...........(2)

Dividing (2) by (1), we get:

tan(33) / tan(15) = (x - 100) / x

Simplifying the expression, we have:

(x - 100) / x = 2.22

Solving for x, we get:

x = 100 / 1.22 ≈ 81.97

Using equation (1), we can solve for the height of the building:

h = x * tan(15)

h ≈ 159.8

Therefore, the height of the building is approximately 159.8 feet.

To know more about height, refer here:

https://brainly.com/question/27917190#

#SPJ11

Natalie budgets $146 for yoga training. She buys a yoga mat for $10 and spends $9 per day on yoga classes. Which inequality represents the number of days, d, that Natalie can take classes and stay within her budget?

Answers

146 (is less than or equal to) 9c + 10

again ignore the erased stuff

Answers

The image contains the answer to the questions.

which hypothesis states that a mean difference between two groups is due to sampling error? group of answer choices null hypothesis alternative hypothesis directional hypothesis nondirectional hypothesis

Answers

The hypothesis that states that the mean difference between two groups is due to sampling error is the null hypothesis.

What is a hypothesis?

A hypothesis is a theory or idea that is proposed and tested to see if it can be proven to be true. It is used to explain a phenomenon and make predictions. A null hypothesis is a type of hypothesis that assumes that there is no significant difference between two groups or variables being studied. It is the default hypothesis that researchers assume to be true unless proven otherwise

If the null hypothesis is proven to be false, it means that there is a significant difference between the groups or variables being studied. In such a case, an alternative hypothesis is formulated.The hypothesis that states that the mean difference between two groups is due to sampling error is the null hypothesis. It assumes that the difference between the groups is due to chance or random sampling errors rather than a real effect. The null hypothesis is tested using statistical tests to see if the results are significant or not. If the results are not significant, it means that there is no evidence to reject the null hypothesis, and the difference between the groups is due to sampling error.

If the results are significant, it means that there is enough evidence to reject the null hypothesis, and the difference between the groups is real and not due to chance or sampling error. Therefore, the null hypothesis is an essential tool in hypothesis testing, and it helps researchers to determine whether the results are meaningful or not.

for such more questions on hypothesis

https://brainly.com/question/606806

#SPJ11

What is the inverse relation of the function f(x)=−72x+4?

Answers

The inverse relation of the function f(x)=−72x+4 is f⁻¹(x) = 4 - y / 72.

What is inverse function?

A function takes in values, applies specific operations to them, and produces an output. The inverse function acts, agrees with the outcome, and returns to the initial function. The graph of the inverse of a function shows the function and the inverse of the function, which are both plotted on the line y = x. This graph's line traverses the origin and has a slope value of 1.

The given function is:

f(x)=−72x+4

Substitute the value of f(x) = y:

y = -72x + 4

Isolate the value of x:

y - 4 = -72x

x = 4 - y / 72

Now, let the value of x be written as f⁻¹(x), thus:

f⁻¹(x) = 4 - y / 72

Hence, the inverse relation of the function f(x)=−72x+4 is f⁻¹(x) = 4 - y / 72.

Learn more about inverse function here:

https://brainly.com/question/30350743

#SPJ9

Answer:

The correct answer is

Need help with these problems

Answers

The aggregate of the interior angles of a nonagon is 1260°The aggregate  of interior angles of a 17-gon is 2700°The aggregate  of the interior angles of a regular hexagon is 720°The aggregate of the interior angles of a regular 20-gon is 3240°The dimensions of each exterior angle of a regular octagon is 45°The dimensions of each exterior angle of a regular 24-gon is 15°In the irregular pentagon in number 7, the measure of x is 14In the hexagon given in 8, the measure of x is 10.

What is the justification for the above response?

1) A nonagon is a polygon with nine sides.

To find the sum of the interior angles of a nonagon, we can use the formula:

aggregate of interior angles = (n - 2) × 180°

where n stands for the number of sides of the polygon.

Substituting n = 9 for a nonagon, we get:

sum of interior angles = (9 - 2) × 180° = 7 × 180°

Thus, the aggregate of the interior angles of a nonagon is:

sum of interior angles = 1260°

2)

To find the sum of the interior angles of a 17-gon, we can use the formula:

aggregate of interior angles = (n - 2) × 180°

where n stands for the number of sides of the polygon.

Substituting n = 17 for a 17-gon, we get:

sum of interior angles = (17 - 2) × 180° = 15 × 180°

Thus, the aggregate of the interior angles of a 17-gon is:

sum of interior angles = 2700°


3)
It is correct to state that a hexagon can be defined as a polygon with six sides.

To find the sum of the interior angles of a hexagon, we can use the formula:

aggregate of interior angles = (n - 2) × 180°

where n refers to the number of sides of the polygon.

Replacing n = 6 for a hexagon, we get:

sum of interior angles = (6 - 2) × 180° = 4 × 180°

Therefore, the sum of the interior angles of a hexagon is:

sum of interior angles = 720°

4)
To find the sum of the interior angles of a regular 20-gon, we can use the formula:

aggregate of interior angles = (n - 2) × 180°

where n refers to the number of sides of the polygon.

Substituting n = 20 for a 20-gon, we get:

sum of interior angles = (20 - 2) × 180 degrees = 18 × 180°

Thus, the sum of the interior angles of a regular 20-gon is:

sum of interior angles = 3,240°

5)
A regular octagon is a polygon with eight sides that are all congruent and eight angles that are all congruent.

To find the measure of each exterior angle of a regular octagon, we can use the formula:

dimensions of each exterior angle = 360° ÷ number of sides

For a regular octagon, the number of sides is 8. Replacing this value into the formula, we get:

measure of each exterior angle = 360° ÷ 8

Simplifying this expression, we get:

the dimensions of each exterior angle = 45°

Therefore, the dimensions of each exterior angle of a regular octagon is 45°.

6)

A regular 24-gon is a polygon with 24 sides that are all congruent and 24 angles that are all congruent.

To find the measure of each exterior angle of a regular 24-gon, we can use the formula:

mensuration of each exterior angle = 360° ÷ number of sides

For a regular 24-gon, the number of sides is 24. Replacing this value into the formula, we get:

measure of each exterior angle = 360° ÷ 24

Simplifying this expression, we get:

The measure of each exterior angle = 15°

Therefore, the measure of each exterior angle of a regular 24-gon is 15°

7)
The sum of the interior angles of any pentagon can be calculated using the formula:

Aggregate of interior angles = (n - 2) × 180°

where n refers the number of sides of the polygon.

For a pentagon, n = 5, so we have:

Aggregate of interior angles = (5 - 2) × 180° = 3 × 180° = 540°.

We can use this fact to set up an equation using the given expressions for the interior angles:

(5x + 2) + (7x - 11) + (13x - 31) + (8x - 19) + (10x - 3) = 540

Simplifying and solving for x, we get:

43x - 62 = 540

43x = 602

x = 14

Therefore, x = 14.

8)

The sum of the exterior angles of any polygon is always 360 degrees. Therefore, we can add the six exterior angles of the hexagon to get:

(11x-30) + 5x + 50 + (2x+60) + (6x-10) + 50 = 360

Simplifying and solving for x, we get:

24x + 120 = 360

24x = 240

x = 10

Therefore, x = 10.

Learn more about nonagon at:

https://brainly.com/question/21094232

#SPJ1

Hi, can you please help with math, I think the exercise solving is probably with x and y. Thank u very much:)

1. Two identical jars of cottage cheese and 3 buns of the same type cost 10 euros. A jar of cottage cheese is 2 euros more expensive than a bun. How much is a jar of cottage cheese and how much is a bun?

Again, Thank u!​

Answers

Answer:

Cost of jar of cottage cheese = € 3.20

Cost of a bun = € 1.20

Step-by-step explanation:

Framing and solving system of linear equations:

Let the cost of 1 jar of cottage cheese = x

                              Let the cost of 1 bun = y

           Cost of 2 jar of cottage cheese  = 2x

                                      Cost of 3 bun    = 3y

Cost of 2 jars of cottage cheese + cost of 3 buns = € 10

         2x + 3y = 10 ------------------(I)

Cost of a jar of cottage cheese = 2 + cost of a bun

               x = 2 + y ----------------(II)

Substitute x = 2 + y in equation (I),

           2*(2+y) + 3y = 10

Use distributive property,

            2*2 + 2*y + 3y = 10

               4 + 2y + 3y = 10

Combine like terms,

                      4 + 5y = 10

Subtract 4 from both sides,

                           5y = 10 - 4

                           5y = 6

Divide both sides by 5

                             y = 6 ÷ 5

                             [tex]\boxed{\bf y = 1.20}[/tex]

Substitute y = 1.2 in equation (II),

        x = 2 + 1.2

        [tex]\boxed{\bf x = 3.20}[/tex]

Answer:

A jar of cottage cheese is €3.20

A bun is €1.20

Step-by-step explanation:

Let

x = Cost of a jar of cottage cheese (euros)

y = Cost of a bun (euros)


Step I:

Translate the statements mathematically:
     2 jars of cottage cheese cost = [tex]2x[/tex] euros

                                  3 buns cost  = [tex]3y[/tex] euros      
                 ∴ Total cost = [tex]2x + 3y = 10[/tex] euros        

A jar of cottage cheese is 2 euros more expensive than a bun: [tex]x = 2 + y[/tex]


Step II:

A system of linear simultaneous equations:

                                         [tex]x = 2 + y[/tex] ——(equation i)

                               [tex]2x + 3y = 10[/tex] ———-(equation ii)

Step III:

Solve the linear simultaneous equations either by the substitution, elimination or graphical method


Substitution method:

Substitute (equation i) into (equation ii) and solve for y:

[tex]2(2 + y) + 3y = 10[/tex]

Expand the parenthesis and make y the subject of the equation:

[tex]4 + 2y + 3y = 10[/tex]

[tex]2y + 3y = 10 - 4[/tex]

[tex]5y = 6[/tex]

[tex]y = \frac{6}{5}[/tex]

y = Cost of a bun = €1.20 (One euro and 20 cents)


Substitute this value of y in any of the equations to solve for x:

[tex]x = 2 + 1.20[/tex]

x = Cost of a jar = €3.20(Three euros and 20 cents)

(31 points!)
A password consists of four different letters of the alphabet, where each letter is used only once.
(a) How many different passwords are possible?

(b) If the numbers 1 through 10 are also available to be chosen only once in addition to the alphabet, how many more passwords are possible?

Answers

Using permutation and combination concept, there are 358,800 different passwords that are possible and the number of more passwords available through this combination is 1054920

How many different passwords are possible?

(a) To find the number of different passwords that are possible, we can use the permutation formula. Since there are 26 letters in the alphabet and we are choosing 4 letters without repetition, we can write:

Number of possible passwords = P(26, 4)

= 26 x 25 x 24 x 23

= 358,800

Therefore, there are 358,800 different passwords that are possible.

(b) If the numbers 1 through 10 are also available to be chosen only once in addition to the alphabet, we can use the same permutation formula to find the number of different passwords that are possible. Since there are now 36 characters to choose from (26 letters + 10 numbers), and we are choosing 4 characters without repetition, we can write:

Number of possible passwords = P(36, 4)

P(36, 4) - P(26, 4) = 1054920

The number of more passwords available through this combination is 1054920

Learn more on permutation here;

https://brainly.com/question/12468032

#SPJ1

Other Questions
A rib fracture can be caused by a direct blow, a violent cough, and/or sneeze The figure (Figure 1) shows the reaction of element A (lavender spheres) with element B (tan spheres). Write the balanced chemical equation for this reaction in terms of A and B .Express your answer as a chemical equation. Describe the end behavior of each function.1. f(x) = -x + 2x -x+4 2. f(x)= x -x -x -1Asking for help please, Thank you A printer company has two locations with a total of 23 employees. If four times the number of employees at the larger location is four greater than seven times the number of employees at the smaller location, how many employees are at each location?a. 8b. 10c. 14d. 16 How does a lawmaker's political affiliation impact his or her vote? Why does this occur? Please help!Questions below! A quadrilateral has two angles that measure 216 and 102. The other two angles are in a ratio of 10:11. What are the measures of those two angles? 2. Determina el esfuerzo en un resorte con un mdulo de Young equivalente a 300 Pascales, si su deformacin es de 30. Alguien me ayuda urgente 15 POINTS. How to do this one please teach by step by step Need help with this I have to study Find the Z-scores for which 50% of the distribution's area lies between -z and z. Click to view page 1 of the table Click to view page 2 of the table. The z-scores are(Use a comma to separate answers as needed Round to two decimal places as needed. ) Case Study B (1500 words) Industry Category: Automobile Manufacturing Company Name: 123 Automobile Location: Abu Dhabi - UAE Go through the case study and answer the questions that follow. In 2018 a new automobile Manufacturing was established in Abu Dhabi UAE, making electrical vehicles (EV). The organization aims to have competitive advantages in relation to the cost, battery operation time, vehicle lifespan, and overall quality to suit the GCC conditions (eg: weather). The company has a strong leadership team and are implementing top leadership strategies. However, the KPIs are not being met and the BOD are not satisfied with the results, especially because of COVID-19. A massive production loss occurred during this period. The company relies heavily on human labor to manufacture the EV, having some of the most talented individuals from the GCC region. Statistics 1,850 Employees 5,723 EV manufactured in 2022 6,750 EV KPI in 2022 8,500 EV KPI in 2023 $1.7m Profits (actual) in 2022 financials $2.5m Profits (KPI) in 2022 $4.3m Profits (KPI) in 2023 Questions: 1. Is the concept of TQM clear throughout the organization? 2. What are the changes required for TQM Culture adoption in this organization? 3. Highlight the contribution of QC to improve quality in a department/function when organizations strive to realize organizational goals and objectives. 4. Do you feel TQM will help in Short Term and/or Long-Term Success? Give your own understanding. 5. How would you implement Kanban system for ABC Pharmaceutical? Give specific examples. 6. How would you implement Kaizen system for ABC Pharmaceutical? Give specific examples infer the consequence for evolution if speices did not vary (1 point) Assume that the monthly wondwide average number of airplaine crashes of commercial ailines is \( 2.2 \). What is the probability that there wili be (a) at most 3 such accidents in the next m Carlos is creating a 3D newspaper. He wants the text to be readable, but currently the lines are so close together that the bottoms of some letters (like y and p) touch the tops of some capital letters on the following line. What should he adjust to fix this problem?Question 11 options:formattingtrackingtypefacingleading ............................. 1. There are three buses A, B and C. the totalnumber of seats in the three buses is 250. 28% ofthe 250 seat are in bus A.number of seats in bus B:number of seats in busC = 3:238 of the seats in bus B are empty. 26 in bus Care empty.Jamie says the percentage of the seats in bus Bthat are empty is greater than the percentage ofthe seats in bus C that are empty. Is Jamiecorrect. Evaluate the traits of the ancient hero Odysseus. How do these traits influence our modern view of a hero? In an essay, appraise Odysseus's character traits and relate these to the character traits of the modern hero. What traits remain and what traits have changed? Why? PLEASE SHOW WORK!!!!!!!!! A rectangular bathroom tile is 2 and 1/3 times as wide as it is tall . If the tile is 5 cm tall,how wide is isA 3 and 2/3 cmB 7 and 1/3 cm C 10 and 1/3 cm Help me find the answer pls