A pilot flies in a straight path for 90​ minutes. She then makes a course correction, heading 20° to the right of her original course, and flies 100 minutes in the new direction. If she maintains a constant speed of 720​ miles per hour, how far is she from her starting position? Round your answer to the nearest mile.

Answers

Answer 1

"To solve this problem, we can use the Law of Cosines. Let's call the distance the pilot travels before the course correction d1 and the distance she travels after the course correction d2. We want to find the distance between her starting position and ending position, which we can call D.

First, let's find d1:

d1 = (720 mph) * (90 min / 60 min) = 1080 miles

Next, let's find d2:

d2 = (720 mph) * (100 min / 60 min) = 1200 miles

Now we can use the Law of Cosines:

D² = d1² + d2² - 2d1d2*cos(20°)

D² = 1080² + 1200² - 210801200*cos(20°)

D ≈ 1169 miles

Therefore, the pilot is approximately 1169 miles from her starting position." (ChatGPT, 2023)


Related Questions

200cm^3 of hydrogen diffuse through a porous pot in 40s. How long will it take 300cm^3 of chlorine to diffuse through the same pot?​

Answers

It will take 300cm³ οf chlοrine 8.76 secοnds tο diffuse thrοugh the same pοrοus pοt.

What is Graham's Law οf Distributiοn?

Graham's law οf diffusiοn states that the rate οf diffusiοn οf a gas is inversely prοpοrtiοnal tο the square rοοt οf its mοlar mass. This means that lighter gases diffuse faster than heavier gases.

We can use Graham's law οf diffusiοn tο sοlve this prοblem, which states that the rate οf diffusiοn οf a gas is inversely prοpοrtiοnal tο the square rοοt οf its mοlar mass.

Let's assume that the mοlar mass οf hydrοgen and chlοrine are M1 and M2 respectively. Then, we can write:

Rate οf diffusiοn οf hydrοgen / Rate οf diffusiοn οf chlοrine = √(M2/M1)

We knοw that 200cm³ οf hydrοgen diffuse thrοugh the pοrοus pοt in 40s. Let's assume that the rate οf diffusiοn οf hydrοgen is R. Then, we can write:

R / Rate οf diffusiοn οf chlοrine = √(M2/M1)

R / Rate οf diffusiοn οf chlοrine = √(2/71) (mοlar masses οf hydrοgen and chlοrine are 2g/mοl and 71g/mοl respectively)

R / Rate οf diffusiοn οf chlοrine = 0.146

Rate οf diffusiοn οf chlοrine = R / 0.146

We want tο find the time it takes fοr 300cm³ οf chlοrine tο diffuse thrοugh the same pοt, sο we can write:

300 / Rate οf diffusiοn οf chlοrine = time

Substituting the value οf Rate οf diffusiοn οf chlοrine, we get:

300 / (R / 0.146) = time

Simplifying, we get:

time = 300 x 0.146 / R

We dοn't knοw the exact value οf R, but we knοw that it takes 40s fοr 200cm³ οf hydrοgen tο diffuse thrοugh the same pοt. Sο we can write:

R = 200 / 40 = 5 cm³/s

Substituting this value in the equatiοn fοr time, we get:

time = 300 x 0.146 / 5 = 8.76 s

Therefοre, it will take 300cm³ οf chlοrine 8.76 secοnds tο diffuse thrοugh the same pοrοus pοt.

To learn more about Graham's Law of Diffusion

https://brainly.com/question/12415336

#SPJ1

Solve for X Round to the nearest 10th if necessary

Answers

The length of the value x in the right triangle is 20.7 units.

How to find the side of a right triangle?

A right triangle is a triangle that has one of its angles as 90 degrees. The sum angles in a triangle is 180 degrees.

Therefore, the side of a right triangle can be found using trigonometric ratios as follows:

Hence,

cos 34° = adjacent / hypotenuse

Therefore,

adjacent side = x

hypotenuse side = 25

Hence,

cos 34 = x  /25

cross multiply

x = 25 cos 34

x = 25 × 0.82903757255

x = 20.7259393139

Therefore,

x = 20.7 units

learn more on right triangle here: https://brainly.com/question/29157263

#SPJ1

a triangle has side lengths of 7, 8 and 12. classify the type of triangle. responses right triangle right triangle acute triangle acute triangle obtuse triangle obtuse triangle doesn't make a triangle doesn't make a triangle

Answers

The type of triangle is an obtuse triangle.

Given that a triangle has side lengths of 7, 8, and 12.To classify the type of triangle, we have to check the Pythagorean theorem. As we know that the Pythagorean theorem states that "In a right-angled triangle, the square of the hypotenuse is equal to the sum of the square of the other two sides.

"Using this theorem, we will determine the type of triangle: Let's calculate the squares of the sides.7² = 49, 8² = 64, 12² = 144. According to the Pythagorean theorem, In the right-angled triangle, the square of the hypotenuse is equal to the sum of the square of the other two sides.

(Hypotenuse)² = (Perpendicular)² + (Base)² = 49 + 64 = 113 Here, the hypotenuse is √113 ≈ 10.63.As 12² > 7² + 8² and 12² > 7² + 8², the triangle is an obtuse triangle. Thus, the type of triangle is an obtuse triangle.

To know more about triangles, refer here:

https://brainly.com/question/2773823#

#SPJ11

What is the answer to 5/8 ÷ 3/4 in fraction form

Answers

Answer:

5/6

Step-by-step explanation:

Renting a roller rink for your birthday costs $150 plus $6 ​ per person. The total charge for your party was $ 282. Translate this information into an equation using
x ​ to represent the number of guests at your party

Answers

The equation that translates the information is $282 = $150 + $6x where x ​ to represent the number of guests at your party

The total charge for renting a roller rink for a birthday party is composed of two parts: a fixed cost of $150 and a variable cost of $6 per person. The variable cost depends on the number of guests, which we can represent with the variable x.

Therefore, the total cost equation can be written as:

Total cost = Fixed cost + Variable cost

Total cost = $150 + $6x

Here, Total cost = $282

So, equation is $282 = $150 + $6x

To find the total charge for a specific number of guests, we can substitute the value of x into the equation and simplify it. For example, if there were 22 guests at the party, the total cost would be:

Total cost = $150 + $6(22)

Total cost = $150 + $132

Total cost = $282

This means that the total charge for a party with 22 guests would be $282.

It's important to note that the fixed cost of $150 is the cost that remains the same no matter how many guests attend the party. On the other hand, the variable cost of $6 per person changes based on the number of guests.

To learn more about cost click on,

https://brainly.com/question/30990143

#SPJ4

A magazine used the summated rating of 10 restaurants to predict the cost of a restaurant meal. For that data, SSR 131,742.28 and SST 143,920.65. Complete parts (a) through (c) a. Determine the coefficient of determination, r2 , and interpret its meaning.
r2 = ____ (Round to two decimal places as needed.))
Interpret the meaning of r2.
It means that _____ % of the variation in the cost of a meal ______ be explained by the variation in summated ratings. (Round to two decimal places as needed.)

Answers

The Coefficient of determination i.e. r²≈ 0.9155.

What is Coefficient of determination?

The coefficient of determination, denoted as r², is a statistical measure that represents the proportion of the variance in the dependent variable that is predictable from the independent variable(s) in a regression model.

To determine the coefficient of determination, we first need to calculate the regression sum of squares (SSR) and the total sum of squares (SST) using the following formulae:

SSR = Σ(y_pred - y_mean)²

SST = Σ(y - y_mean)²

where y_pred is the predicted value of y based on the regression equation, y_mean is the mean of y, and y is the actual value of y.

Once we have calculated SSR and SST, we can use the formula for the coefficient of determination:

r² = SSR / SST

Using the given values, we have:

SSR = 131,742.28

SST = 143,920.65

r² = SSR / SST = 131,742.28 / 143,920.65 ≈ 0.9155

Interpreting the meaning of r², we can say that approximately 91.55% of the variation in the cost of a meal can be explained by the variation in summated ratings. In other words, the model based on summated ratings is able to explain a large proportion of the variability in the cost of a meal.

To learn more about Coefficient of determination, visit the link:

https://brainly.com/question/30100228

#SPJ1

whats 18 divided by 800 solved

Answers

Answer:

Step-by-step explanation:44,4444444

Answer:

0.0225

Step-by-step explanation:

18÷800=0.0225

Janelle weighed an unknown substance. It had a mass of 20. 609 grams. She exposed the substance to a flame and carefully weighed the substance again. The substance then had a mass of 17. 39 grams. Write and solve an equation to determine the amount of mass x the substance lost. ​

Answers

Janelle calculated that the unknown weighed lost 3.219 grams of mass when exposed to a flame.

Janelle weighed an unknown substance to determine its mass. The initial mass was 20. 609 grams. She then exposed the substance to a flame, and carefully weighed it again. This time, the mass was 17. 39 grams. To determine the amount of mass x the substance lost, Janelle can write and solve an equation. The equation would be:  20.609 - 17.39 = x, where x is the amount of mass lost. To solve for x, Janelle can subtract 17.39 from 20.609. This calculation would result in x = 3.219, meaning the substance lost 3.219 grams of mass. Therefore, the amount of mass x the substance lost is 3.219 grams.

Learn more about weight here

https://brainly.com/question/28355526

#SPJ4

Label the vertices coordinates after a dilation a scale factor of one-half, centered at the origin.

Answers

After dilatiοn , the cοοrdinates are  J'(-2,2), K'(2,2) , L'(4,4) and  M'(0,4).

What dο yοu mean by dilatiοn ?

Resizing an item uses a transitiοn called dilatiοn. Dilatiοn is used tο enlarge οr cοntract the items. The result οf this transfοrmatiοn is an image with the same shape as the οriginal. Yet, there is a variatiοn in the shape's size. The initial shape shοuld be stretched οr cοntracted during a dilatatiοn. The phrase "scale factοr" describes this transitiοn.

Here the given vertices cοοrdinate οf the image is

J(-4,4) , K(4,4) , L(8,8) and M(0,8).

Scale factor = [tex]\frac{1}{2}[/tex]

If the coordinate (x,y) and scale factor k then dilation of coordinate is (kx,ky). Then,

=> J(-4,4) --> J'[tex](\frac{1}{2}\times -4,\frac{1}{2}\times 4)[/tex] = J'(-2,2).

=> K(4,4) --> K'[tex](\frac{1}{2}\times 4,\frac{1}{2}\times 4)[/tex] = K'(2,2)

=> L(8,8) --> L'[tex](\frac{1}{2}\times 8,\frac{1}{2}\times 8)[/tex] = L'(4,4)

=> M(0,8) --> M'[tex](\frac{1}{2}\times 0,\frac{1}{2}\times 8)[/tex] = M'(0,4).

Hence after dilation the coordinates are  J'(-2,2), K'(2,2) , L'(4,4) and  M'(0,4).

To learn more about dilation refer the below link

https://brainly.com/question/30240987

#SPJ1

Work out 2/5 x 1 4/7 Give your answer and a fraction in its simplest form.

Answers

Answer:

0.62

Step-by-step explanation:

given :
[tex]\frac{2}{5} * 1\frac{4}{7}[/tex]
[tex]=\frac{2}{5} *\frac{11}{7}[/tex]
[tex]= \frac{22}{35}[/tex]
[tex]=0.62[/tex] as a decimal

Hope it helps

In Rhombus THRY, Angle H is 3x+51, and Angle T is 2x+44, what is the measure of angle Y 102 90 88 78

Answers

The sοlutiοn οf the given prοblem οf angles cοmes οut tο be the angle Y has a 78 degree value.

An angle meaning is what?

The twο circular lines that fοrm the ends οf a skew in Cartesian cοοrdinates are divided by the tοp and bοttοm οf the wall. Twο beams cοlliding may result in a junctiοn pοint. Angle is anοther οutcοme οf twο things interacting. They resemble dihedral shapes the mοst. A twο-dimensiοnal curve can be created by arranging twο line beams in variοus cοnfiguratiοns at their ends.

Here,

Oppοsing angles are equivalent in a rhοmbus. As a result, we have:

=> Angle H = Angle R = 3x + 51

=> Angle T = Angle Y = 2x + 44

Any quadrilateral's internal angles, including thοse in a rhοmbus, add up tο 360 degrees. Cοnsequently, we can write:

=> Angle H + Angle R + Angle T + Angle Y = 360

With the fοrmulas fοr each angle substituted, we οbtain:

=> (3x + 51) + (3x + 51) + (2x + 44) + (2x + 44) = 360

By cοndensing the left half, we οbtain:

=> 10x + 190 = 360

190 frοm bοth parts are subtracted, giving us:

=> 10x = 170

When we divide by 10, we get:

=> x = 17

Nοw we can determine the angle Y's measurement:

=> Angle Y = 2x + 44

=> Angle Y = 2(17) + 44

=> Angle Y = 34 + 44

=> Angle Y = 78

As a result, the angle Y has a 78 degree value.

To know more about angles visit:

brainly.com/question/14569348

#SPJ1

PLEASE HELPPP MEEEEEEEE

Answers

The equation that models the relationship between the models to show Ethan's employee benefits is y = 14 + 3(x - 1).

The number of paid vacation days Ethan earned was 35 paid vacation days .

Ethan will reach the maximum number of paid vacation days in 7 years.

How to find the paid vacation days ?

Let x represent the number of years he has worked for this employer and y represent the number of paid vacation days he has earned.

The equation that models the relationship between x (years worked) and y (paid vacation days earned) is:

y = 14 + 3(x - 1)

Using the equation from part a, we can find out how many paid vacation days Ethan has earned after eight years:

y = 14 + 3(8 - 1)

y = 14 + 3(7)

y = 14 + 21

y = 35

To determine when Ethan will reach the maximum number of paid vacation days, we can set y equal to 30 and solve for x:

30 = 14 + 3(x - 1)

16 = 3(x - 1)

16/3 = x - 1

x = 16/3 + 1

x = 16/3 + 3/3

x = 19/3

x = 7

Find out more on equations at https://brainly.com/question/19260584

#SPJ1

Copy and complete the definitions below by choosing the correct fractions. < Back to task COS X = sin x = tan x = Watch video length of opposite side length of adjacent side length of adjacent side length of hypotenuse length of opposite side length of hypotenuse Answer>​

Answers

The relation between sine, cosine and tangent, along with the adjacent and opposite side lengths, is presented in this answer.

What are the trigonometric ratios?

The three trigonometric ratios are the sine, the cosine and the tangent, and they are defined as follows:

Sine of angle = length of opposite side to the angle divided by the length of the hypotenuse.Cosine of angle = length of adjacent side to the angle divided by the length of the hypotenuse.Tangent of angle = length of opposite side to the angle divided by the length of the adjacent side to the angle.

Missing Information

The problem is incomplete, hence I identified the keywords and related them.

More can be learned about trigonometric ratios at brainly.com/question/24349828

#SPJ1

Cindy has read 13 chapters of a 22 chapter book. What percent of the chapter has she read?

Answers

59.1%

Step-by-step explanation:

100% / 22 x 13 =59.1%

David bought 200 shares of Oracle stock yesterday and sold it today. His profit was $22. 0. At what price did he buy the stock yesterday?

Answers

Assuming that David sold the stock at $10 per stock today, then, we will agree that he bought the Oracle stock yesterday at a price of approximately $9.89 per share.

How do we calculate the price he bought the stock yesterday?

A share, also known as a stock or equity, is a unit of ownership in a corporation. Stock investments provide investors with returns in the form of dividends and capital gains. The higher the expected returns, the more shares an investor owns.

Let the price at which David bought each share of Oracle stock yesterday be x. Then, his total cost for buying 200 shares would be: 200x

Similarly, his total revenue for selling 200 shares at $10 per share today would be:

= 200*($10)

= $2000

His profit was $22, so we can set up the equation which is $2000 - 200x = $22.

Simplifying and solving for x, we get:

$1978 = 200x

x = $1971/200

x = $9.89.

Read more about stock price

brainly.com/question/28143339

#SPJ1

Suppose that X is normally distributed with mean 110 and
standard deviation 17.
A. What is the probability that X is greater than 138.05?
Probability =
B. What value of X does only the top 15% exceed?

Answers

Mean = 110

Standard Deviation = 17

The solution is given below:A. What is the probability that X is greater than 138.05?We have, Mean (μ) = 110Standard Deviation (σ) = 17Let's first standardize X = 138.05: Z = (X - μ)/σZ = (138.05 - 110)/17 = 1.650Therefore, P(X > 138.05) = P(Z > 1.650)Using a standard normal table, the probability of Z being greater than 1.650 is:0.0495Probability = 0.0495B. What value of X does only the top 15% exceed?We have, Mean (μ) = 110Standard Deviation (σ) = 17We need to find the value of X such that only the top 15% exceed. In other words, we want to find X such that P(X > x) = 0.15.Using a standard normal table, we can find that the Z-value for the top 15% is 1.0364. We can write this as:P(Z > 1.0364) = 0.15We now standardize the equation:P(Z > 1.0364) = 0.15Z = invNorm(0.15) + 1.0364Z = -1.0364 + 1.0364Z = 0Therefore, we have:Z = (X - μ)/σ0 = (X - 110)/17X = 110Therefore, the value of X such that only the top 15% exceed is 110.

Learn more about standard deviation

brainly.com/question/29088233

#SPJ4

A. The probability that X is greater than 138.05 is 0.0492.

B. The value of X does only the top 15% exceed is 127.57.

Given that X is normally distributed with mean 110 and standard deviation 17.

A. Probability= P(X > 138.05)

First, we need to calculate the z-score of 138.05 by using the formula;

z = (X - μ)/σ

Where

X = 138.05, μ = 110, and σ = 17z = (138.05 - 110)/17 = 1.649

Therefore, P(X > 138.05) = P(Z > 1.649)

Using a standard normal table, the probability P(Z > 1.649) = 0.0492

Thus, the probability that X is greater than 138.05 is 0.0492.

B. We know that the mean of the normal distribution is 110 and the standard deviation is 17, and we need to find the value of X such that only the top 15% exceed.

Therefore, we need to find the value of X such that P(X > x) = 0.15

Using a standard normal table, we find that the Z-value of 0.15 is 1.0364

Therefore, z = (x - μ)/σ = 1.0364

Solving for x, we get,

x = σz + μ = 17 × 1.0364 + 110 = 127.57

Thus, the value of X that only the top 15% exceed is 127.57.

Learn more about probability at https://brainly.com/question/17007499

#SPJ11

Find x give brief reason

Answers

Q1 . By pytagorean therom ,

CA ^ 2 + AB ^2 = BC^2

2^2 +4^2 = BC^2

4 + 16 = BC ^2

20 = BC^2

BC = [tex]\sqrt{20}[/tex]

BC = 4.4

1/2 BC = x = 2.2 ( Midpoint)

Q2 .

OQP = 90

(5+X)^2 = X^2 + 7^2

25 + 10X + X^2 = X^2 + 49

25 + 10X = 49

10X = 49 - 25 = 24

X = 2.4


Answer:

see explanation

Step-by-step explanation:

(a)

the angle in a semicircle is a right angle , then Δ ABC is right with ∠ BAC = 90°

the radius of the circle OB = x , then BC = 2x

using Pythagoras' identity in the right angle

BC² = AB² + AC²

(2x)² = 4² + 2²

4x² = 16 + 4 = 20 ( divide both sides by 4 )

x² = 5 ( take square root of both sides )

x = [tex]\sqrt{5}[/tex]

-----------------------------------------------------------------

the angle between a tangent and the radius of the circle at the point of contact is 90° , that is

∠ OQP = 90° and Δ OPQ is right

note that OP = 5 + radius = 5 + x

using Pythagoras' identity in the right triangle

OP² = OQ² + PQ²

(5 + x)² = x² + 7² ← expand left side using FOIL

25 + 10x + x² = x² + 49  ( subtract x² from both sides )

25 + 10x = 49 ( subtract 25 from both sides )

10x = 24 ( divide both sides by 10 )

x = 2.4

A geometric solid has 12 faces and 25 vertices. How many vertices does the solid have?

Answers

Answer: 35

Step-by-step explanation:

 Let's use Euler's formula to solve this problem. According to Euler's formula, for any convex polyhedron (geometric solid with flat faces), the number of faces (F), vertices (V), and edges (E) satisfy the equation F + V - E = 2.

We are given that the geometric solid has 12 faces and 25 vertices. Let's call the number of edges "E" and substitute these values into Euler's formula:

12 + 25 - E = 2

Simplifying this equation, we get:

E = 35

Therefore, the geometric solid has 35 edges.

you and your family went to riverside cafe for dinner and the total bill was $54.95. since you have a hawk card, you can get a 20% discount. how much would you save using your hawk card? what would be the final amount you pay?

Answers

To find the amount of the discount, we can multiply the total bill by the discount rate of 20% (or 0.2):

Discount = 0.2 x $54.95

Discount = $10.99

What is percentage ?

Percentage is a way of expressing a fraction or proportion as a portion of 100. It is often used to represent rates, discounts, or increases/decreases in values.

So you would save $10.99 using your Hawk card.

To find the final amount you would pay after the discount, we can subtract the discount from the total bill:

Final amount = Total bill - Discount

Final amount = $54.95 - $10.99

Final amount = $43.96

So the final amount you would pay with the Hawk card discount is $43.96.
Learn more about percentage

https://brainly.com/question/24877689

#SPJ1

solve for x and y be sure to show your work

Answers

Answer:

x = 3√7.

y = 12.

Step-by-step explanation:

The 2 triangles are similar so:

x/9 = 7/x

x^2 = 63

x = √63

   = 3√7.

By Pythagoras' theorem

y^2 = 9^2 + (3√7)^2

      =  81 + 63

      = 144

y = 12.

Regan is admiring a statue in Castroville Park from 12 meters away. If the distance between
the top of the statue to Regan's head is 20 meters, how much taller is the statue than Regan?

Answers

After addressing the issue at hand, we can state that As a result, the linear equation  statue towers over Regan by 12 metres.

What is a linear equation?

In algebra, a linear equation refers to one with its form y=mx+b. B is the gradient, and m is the esta. The preceding clause is commonly referred to as a "linear function with two variables" so even though y and x are variables. Bivariate linear equations are linear equations with two variables. There are several linear equations: 2x - 3 = 0, 2y = 8, m + 1 = 0, x/2 = 3, x + y = 2, and 3x - y + z = 3. When an equation seems to have the structure y=mx+b, where m is the slope and b is the y-intercept, it is said to be linear. When a measurement seems to have the formula y=mx+b, both with m identifying its slope and b denoting the y-intercept, it is said to be linear.

Let's call the statue's height "h". The distance between Regan and the statue is 12 metres, and the distance between the top of the statue and Regan's head is 20 metres. To visualise the situation, we can draw the following diagram:

  Regan

       |

       | 20 m

       |

       |

       o-----|-----o

      Statue  12 m

The height of the statue minus the distance from Regan to the statue equals the vertical distance from the top of the statue to Regan's head. So far, we have:

h - 12 = 20

When we solve for h, we get:

h = 32

As a result, the statue stands 32 metres tall. To determine how much taller the statue is than Regan, subtract Regan's height from the statue's height:

32 - 20 = 12

As a result, the statue towers over Regan by 12 metres.

To know more about linear equation visit:

https://brainly.com/question/11897796

#SPJ1

Find the value of x.

Answers

Answer:

[tex]\large\boxed{\textsf{x=3}}[/tex]

Step-by-step explanation:

[tex]\textsf{We are asked to find the value of x.}[/tex]

[tex]\textsf{Notice that we have Intersecting Chords inside of the circle.}[/tex]

[tex]\large\underline{\textsf{What are Chords?}}[/tex]

[tex]\textsf{Chords are line segments that have endpoints on the circumference of a circle.}[/tex]

[tex]\textsf{Note that some Chords can be Diameters, but not for this problem. There's no Center.}[/tex]

[tex]\textsf{These Chords don't create Perpendicular Lines, which means the angles aren't equal.}[/tex]

[tex]\textsf{We can identify the unknown angles with a postulate.}[/tex]

[tex]\large\underline{\textsf{What is a Postulate?}}[/tex]

[tex]\textsf{A Postulate is a statement that can never be false. No matter what, it's always}[/tex]

[tex]\textsf{true.}[/tex]

[tex]\textsf{We can use the Linear Pair Postulate to find the needed angle.}[/tex]

[tex]\large\underline{\textsf{What is the Linear Pair Postulate?}}[/tex]

[tex]\textsf{Linear Pair Postulate is a Postulate that proves 2 angles add up to 180}^{\circ}.[/tex]

[tex]\textsf{A Linear Pair is 2 Adjacent Angles that form a Straight Angle.}[/tex]

[tex]\large\underline{\textsf{For our Problem;}}[/tex]

[tex]\tt \angle HLJ \ and \ \angle ILJ \ are \ Linear \ Pairs.[/tex]

[tex]\large\underline{\textsf{Find} \ \angle \textsf{HLJ;}}[/tex]

[tex]\tt \angle HLJ + \angle ILJ = 180^{\circ}.[/tex]

[tex]\tt \angle HLJ + 85.5^{\circ} = 180^{\circ}.[/tex]

[tex]\underline{\textsf{Subtract 85.5 from both sides of the equation;}}[/tex]

[tex]\tt \angle HLJ = 94.5^{\circ}[/tex]

[tex]\textsf{Now that we have} \tt \ \angle HLJ, \textsf{we can find x.}[/tex]

[tex]\textsf{We are given 2 arc measures and we have 2 Intersecting Chords.}[/tex]

[tex]\textsf{We should use} \tt \ \angle HLJ \ \textsf{to find x.}[/tex]

[tex]\large\underline{\textsf{How?}}[/tex]

[tex]\textsf{The Angle is equal to half the sum of the 2 arcs.}[/tex]

[tex]\underline{\textsf{For our Problem;}}[/tex]

[tex]\tt \angle HJL = \frac{1}{2} (42x-6 + 15x+24)[/tex]

[tex]\tt 94.5^{\circ} = \frac{1}{2} (42x-6 + 15x+24)[/tex]

[tex]\large\underline{\textsf{Solve;}}[/tex]

[tex]\textsf{Multiply each side by 2 first.}[/tex]

[tex]\tt 189^{\circ} = 42x-6 + 15x+24[/tex]

[tex]\underline{\textsf{Combine Like Terms;}}[/tex]

[tex]\tt 189^{\circ} = 57x+18[/tex]

[tex]\underline{\textsf{Subtract 18 from both sides;}}[/tex]

[tex]\tt 171^{\circ} = 57x[/tex]

[tex]\underline{\textsf{Divide each side by 57;}}[/tex]

[tex]\large\boxed{\textsf{x=3}}[/tex]

The length of time, in minutes, for an airplane to obtain clearance for takeoff at a certain airport is a random variable Y=3X−2, where X has the density function f(x) = ¼ e^−x/4, for x > 0, f(x) = 0, elsewhere. Find the mean and variance of the random variable Y.

Answers

The mean of Y is -5/4 and the variance of Y is 144.

What is mean?

In statistics, the mean is a measure οf central tendency that represents the average οf a set οf data. It is alsο knοwn as the arithmetic mean. The mean is calculated by adding up all the values in the dataset and dividing the sum by the tοtal number οf values. It is οften used tο describe the typical οr average value in a set οf data.

What is variance?  

Variance is a statistical measure that describes hοw much the values in a set οf data vary frοm the average value οr mean. It measures the spread οr dispersiοn οf the data pοints arοund the mean.

In the given questiοn,

Tο find the mean and variance οf the randοm variable Y, we need tο use the fοrmulas fοr the expected value and variance οf a functiοn οf a randοm variable:

The expected value (mean) of Y is given by:

E(Y) = E(3X - 2) = 3E(X) - 2

The variance of Y is given by:

Var(Y) = Var(3X - 2) = 9Var(X)

To find E(X), we need to integrate the density function f(x) over all possible values of X:

E(X) = ∫0∞ x f(x) dx

= ∫0∞ x (1/4)[tex]\rm e^{(-x/4)[/tex]dx

This integral can be solved using integration by parts, with u = x and dv/dx = (1/4)[tex]\rm e^{(-x/4)[/tex] dx.

Integrating by parts, we get:

E(X) = [-x/4 [tex]\rm e^{(-x/4)[/tex]]_0∞ + ∫0∞ (1/4)[tex]\rm e^{(-x/4)[/tex] dx

= [0 + (1/4)]/1 + [0]

= 1/4.

Therefore, the expected value of Y is:

E(Y) = 3E(X) - 2 = 3(1/4) - 2 = -5/4.

To find Var(X), we can use the formula for the variance of an exponential distribution, which is:

Var(X) = (1/λ²) = (4²) = 16.

Therefore, the variance of Y is:

Var(Y) = 9Var(X) = 9(16)

= 144.

Therefore, the mean of Y is -5/4 and the variance of Y is 144.

To know more about Variance , visit:

https://brainly.com/question/29727198

#SPJ1

The mean of Y is 10 minutes, and the variance of Y is 144 minutes squared.

What is integration?

Integration is a mathematical operation that is the reverse of differentiation. Integration involves finding an antiderivative or indefinite integral of a function.

To find the mean and variance of Y, we will first need to find the mean and variance of X.

Mean of X:

The mean of X is given by:

E(X) = integral from 0 to infinity of xf(x) dx

E(X) = integral from 0 to infinity of x * 1/4 e^(-x/4) dx

Using integration by parts with u = x and dv = e^(-x/4) dx, we can evaluate this integral to get:

E(X) = 4

Variance of X:

The variance of X is given by:

Var(X) = E(X^2) - [E(X)]^2

We will first need to find E(X^2). Using integration by parts again, we can evaluate this integral as:

E(X^2) = integral from 0 to infinity of x^2 * 1/4 e^(-x/4) dx

E(X^2) = 32

Therefore, the variance of X is:

Var(X) = E(X^2) - [E(X)]^2

Var(X) = 32 - 16

Var(X) = 16

Now, we can use the formula for the mean and variance of a linear transformation of a random variable to find the mean and variance of Y.

Mean of Y:

The mean of Y is given by:

E(Y) = E(3X - 2)

E(Y) = 3E(X) - 2

E(Y) = 10

Variance of Y:

The variance of Y is given by:

Var(Y) = Var(3X - 2)

Var(Y) = 9Var(X)

Var(Y) = 144

Therefore, the mean of Y is 10 minutes, and the variance of Y is 144 minutes squared.

To learn more about integration from the given link:

https://brainly.com/question/18125359

#SPJ1

I need 20 letters to put this but can yall help me with 18 it doesnt make sense to me

Answers

Answer:

B. 390 Miles.

Step-by-step explanation:

We're given that Justine travels 20 miles one way to her company's main office every week from Monday to Thursday. On Friday, she travels 50 miles to her company's regional office.

Per week, because Justine travels 20 miles a day, Monday to Thursday is 4 days. To figure this out, we would simply need to divide.

[tex]4\times20[/tex]

[tex]80[/tex]

On Friday, adding on the 50 miles:

[tex]80+50[/tex]

[tex]130[/tex]

Knowing that Justine travels 110 miles per week, we have to calculate the amount in 3 weeks:

[tex]130\times3[/tex]

[tex]390[/tex]

Therefore, Justine traveled 390 miles.

Thanks.

Algebra 1 T.16 Compare linear functions: tables, graphs, and equations GD7 Function A and Function B are linear functions. -10 -8 -6 Function A 104X Which statement is true? 6 2 02 -4 6 -8 -10 2 4 6 8 10 Function B X -1 6 9 The slope of Function A is greater than the slope of Function B. The slope of Function A is less than the slope of Function B. -3 11 17 Video O Qu an 00 Sma out c​

Answers

Answer:

To compare the slopes of Function A and Function B, we need to find the slope of each function.

Function A: y = 104x

The slope of a linear function in the form y = mx + b is equal to the coefficient of x, which is 104 in this case. Therefore, the slope of Function A is 104.

Function B: y = -x + 7

The slope of a linear function in the form y = mx + b is equal to the coefficient of x, which is -1 in this case. Therefore, the slope of Function B is -1.

Since 104 is greater than -1, the statement "The slope of Function A is greater than the slope of Function B" is true.

Therefore, the answer is: The slope of Function A is greater than the slope of Function B.

A tennis court is 78 feet long with the net located at the center. The distance from the net to the back of the service box is 21 feet, and the net is 3 feet tall. Assuming Carina can hit the ball so hard that its path is linear, from what height must she hit the ball to have the serve just clear the net and land in the service box? Decide whether or not it is reasonable for Carina to reach this height if she is 5′7" tall. Also, at what angle does the ball hit the ground? Your solution should include: A labeled diagram that shows a bird's-eye view of the path of the ball. A labeled diagram that shows the side view of Carina, the ideal height of the tennis racket, the ideal path of the tennis ball, and the measurements that are needed from the bird's-eye view diagram.

Answers

Carina needs to hit the ball at a height of about 3.04 feet to clear the net and land in the service box.

What is the trigonometric ratio?

There are six trigonometric ratios- sine(sin), cosine(cos), tangent(tan), cotangent(cot), secant(sec), cosecant(cosec). Let θ be the angle of the right-angled triangle then, sin θ = opposite side/hypotenuse or 1/cosθ.

To determine the height Carina needs to hit the ball to clear the net and land in the service box, we can use the following steps:

Draw a bird's-eye view diagram of the tennis court, including the net, the service box, and the path of the ball.

Draw a side view diagram of Carina and the ideal path of the tennis ball, including the measurements that are needed from the bird's-eye view diagram.

Use trigonometry to calculate the height Carina needs to hit the ball.

Determine whether it is reasonable for Carina to reach this height, given her height of 5'7".

Calculate the angle at which the ball hits the ground.

Here are the steps in more detail:

Bird's-eye view diagram:

We can draw a bird's-eye view diagram of the tennis court, with the net located at the center and the service box 21 feet away from the net. The distance from the net to the service box is (78-21)/2 = 28.5 feet. We can label the diagram with these distances and the height of the net (3 feet).

Side view diagram:

Next, we can draw a side view diagram that shows Carina, the ideal path of the tennis ball, and the measurements that are needed from the bird's-eye view diagram. We can label the diagram with the height of the tennis racket (h) and the distance from the racket to the net (x). We also need to label the height Carina needs to hit the ball to clear the net (y) and the height of the net (3 feet).

Calculate the height Carina needs to hit the ball:

To calculate the height Carina needs to hit the ball, we can use the following trigonometric formula:

tan(θ) = y / x

where theta is the angle between the ideal path of the ball and the ground, y is the height Carina needs to hit the ball, and x is the distance from the racket to the net.

Solving for y, we get:

y = x * tan(θ)

We know that x = 21 feet, and we can estimate that the angle theta is about 8 degrees (since the ball needs to clear the net by at least 3 feet). Plugging in these values, we get:

y = 21 * tan(8) = 3.04 feet

So Carina needs to hit the ball at a height of about 3.04 feet to clear the net and land in the service box.

Determine whether it is reasonable for Carina to reach this height:

Carina's height is 5'7", which is equivalent to 67 inches.

If we assume that Carina's arm reaches to about shoulder height, which is roughly halfway between her height and the height she needs to hit the ball (3.04 feet), then she would need to hit the ball about 1.5 feet above her shoulder.

This seems like a reasonable height for a skilled tennis player.

Calculate the angle at which the ball hits the ground:

To calculate the angle at which the ball hits the ground, we can use the following trigonometric formula:

tan(θ) = y / (x + d)

where d is the distance from the net to where the ball lands. We know that y = 3.04 feet, x = 21 feet, and d = 21 + 21 = 42 feet (since the ball travels the same distance on the other side of the court). Plugging in these values, we get:

tan(θ) = 3.04 / 42

θ = arctan(3.04 / 42)

θ = 0.07225

Hence, Carina needs to hit the ball at a height of about 3.04 feet to clear the net and land in the service box.

To learn more about the trigonometric ratio visit:

https://brainly.com/question/30339634

#SPJ1

The standard form of a quadratic function is f(x)=a(x-h)^+k true or false

Answers

Hence, in response to the provided question, we can say that the constant k denotes the graph's vertical shift. The coefficient "a" specifies the function's opening direction and amount.

what is function?

Mathematicians research numbers and their variants, equation and related structures, objects and their locations, and prospective locations for these things. The term "module" is used to describe the connection that exists in between set of inputs, each of which has a corresponding output. A function is an input-output connection in which each inputs results in something like a single, distinct return. A domain, codomain, or scope is assigned to each function. Functions are usually denoted by the letter f. (x). An x is used for entry. On capabilities, one-to-one capabilities, multiple prowess, in capabilities, and on capabilities are the four major types of accessible functions.

False.

A quadratic function has the usual form [tex]f(x) = a(x - h)^2 + k[/tex], where "a," "h," and "k" are constants that determine the shape, position, and orientation of the quadratic function's graph. The phrase (x - h)2 denotes the squared distance between the input value x and the horizontal shift h, while the constant k denotes the graph's vertical shift. The coefficient "a" specifies the function's opening direction and amount.

To know more about function visit:

https://brainly.com/question/28193995

#SPJ1

How to rewrite the problem so it only had positive exponents

Answers

To rewrite a problem with negative exponents into a problem with positive exponents, you can use the following rules.

Move any negative exponent to the denominator (or numerator, depending on where it is located) by changing the sign of the exponent to positive.

If there are any fractions with negative exponents, flip the fraction so that the exponent becomes positive.

For example, if you have the expression:

[tex]X^-2 / y^-3[/tex]

To rewrite this with positive exponents, you can move the negative exponents to the denominator and change the signs:

[tex]y^3 / x^2[/tex]

learn more about numerator here:

https://brainly.com/question/11156074

#SPJ4

PLEASE HELP THANK YOU A restaurant makes smoothies in batches of 6.4 litres. The smoothies are made from ice cream and a mixed fruit juice in the ratio 5 : 3. 35% of the juice is lime juice. Work out the maximum number of batches of smoothie that can be made from 42 litres of lime juice.​

Answers

The maximum number of batches of smoothie that can be made from 42 litres of lime juice is 50.

What is the amount of mixed fruit juice required?

To determine the amount of mixed fruit juice required to make a batch of smoothie, we need to find the total volume of ice cream and mixed fruit juice in a batch.

The ratio of ice cream to mixed fruit juice is 5 : 3, which means that the total ratio of ingredients in a batch of smoothie is 5 + 3 = 8.

Since the batch size is 6.4 litres, the volume of mixed fruit juice required per batch is:

3/8 x 6.4 litres = 2.4 litres

Next, we need to determine the amount of lime juice in each batch. If 35% of the mixed fruit juice is lime juice, then the amount of lime juice in each batch is:

35/100 x 2.4 litres = 0.84 litres

Now we can determine the number of batches of smoothie that can be made from 42 litres of lime juice.

The amount of lime juice required per batch is 0.84 litres, so the maximum number of batches that can be made from 42 litres of lime juice is:

42 litres ÷ 0.84 litres per batch = 50 batches

Learn more about batch mixing here: https://brainly.com/question/28390600

#SPJ1

Simon and his track team ran on the Heron Peak running trail yesterday after school. The team ran 2 miles due west from the parking lot to a bench. They turned at the bench to run 1.5 miles due north toward an outhouse. To finish the run, the team ran a straight line from the outhouse back to the parking lot. If Simon ran at a constant rate of 8 miles per hour, how long did it take Simon to finish the run?
If necessary, round your answer to the nearest tenth.
how many minutes?

Answers

It took Simon 45 minutes to finish the run.

What is distance?

Distance is the measure of how far apart two objects or locations are from each other. It is usually measured in units such as meters, kilometers, miles, or feet.

To solve this problem, we need to use the distance formula:

Distance = Rate x Time

We can break down the run into three parts: the 2 miles due west, the 1.5 miles due north, and the straight line back to the parking lot.

For the first part, Simon ran 2 miles at a rate of 8 miles per hour. Therefore, the time it took him to run this part of the trail was:

Time = Distance / Rate

Time = 2 miles / 8 miles per hour

Time = 0.25 hours

For the second part, Simon ran 1.5 miles at a rate of 8 miles per hour. Therefore, the time it took him to run this part of the trail was:

Time = Distance / Rate

Time = 1.5 miles / 8 miles per hour

Time = 0.1875 hours

To find the distance of the last part, we need to use the Pythagorean theorem to find the hypotenuse of the right triangle formed by the 2-mile and 1.5-mile legs:

c² = a² + b²

c² = 2² + 1.5²

c² = 4 + 2.25

c² = 6.25

c = sqrt(6.25)

c = 2.5 miles

So, Simon ran 2.5 miles at a rate of 8 miles per hour. Therefore, the time it took him to run this part of the trail was:

Time = Distance / Rate

Time = 2.5 miles / 8 miles per hour

Time = 0.3125 hours

Finally, we can add up the times for each part of the trail to find the total time it took Simon to finish the run:

Total Time = 0.25 hours + 0.1875 hours + 0.3125 hours

Total Time = 0.75 hours

To convert this to minutes, we can multiply by 60:

Total Time = 0.75 hours x 60 minutes/hour

Total Time = 45 minutes

Therefore, it took Simon 45 minutes to finish the run.

To learn more about distance from the given link:

https://brainly.com/question/30923151

#SPJ1

Other Questions
The figure (Figure 1) shows the reaction of element A (lavender spheres) with element B (tan spheres). Write the balanced chemical equation for this reaction in terms of A and B .Express your answer as a chemical equation. Describe the end behavior of each function.1. f(x) = -x + 2x -x+4 2. f(x)= x -x -x -1Asking for help please, Thank you A printer company has two locations with a total of 23 employees. If four times the number of employees at the larger location is four greater than seven times the number of employees at the smaller location, how many employees are at each location?a. 8b. 10c. 14d. 16 How does a lawmaker's political affiliation impact his or her vote? Why does this occur? Please help!Questions below! A quadrilateral has two angles that measure 216 and 102. The other two angles are in a ratio of 10:11. What are the measures of those two angles? 2. Determina el esfuerzo en un resorte con un mdulo de Young equivalente a 300 Pascales, si su deformacin es de 30. Alguien me ayuda urgente 15 POINTS. How to do this one please teach by step by step Need help with this I have to study Find the Z-scores for which 50% of the distribution's area lies between -z and z. Click to view page 1 of the table Click to view page 2 of the table. The z-scores are(Use a comma to separate answers as needed Round to two decimal places as needed. ) Case Study B (1500 words) Industry Category: Automobile Manufacturing Company Name: 123 Automobile Location: Abu Dhabi - UAE Go through the case study and answer the questions that follow. In 2018 a new automobile Manufacturing was established in Abu Dhabi UAE, making electrical vehicles (EV). The organization aims to have competitive advantages in relation to the cost, battery operation time, vehicle lifespan, and overall quality to suit the GCC conditions (eg: weather). The company has a strong leadership team and are implementing top leadership strategies. However, the KPIs are not being met and the BOD are not satisfied with the results, especially because of COVID-19. A massive production loss occurred during this period. The company relies heavily on human labor to manufacture the EV, having some of the most talented individuals from the GCC region. Statistics 1,850 Employees 5,723 EV manufactured in 2022 6,750 EV KPI in 2022 8,500 EV KPI in 2023 $1.7m Profits (actual) in 2022 financials $2.5m Profits (KPI) in 2022 $4.3m Profits (KPI) in 2023 Questions: 1. Is the concept of TQM clear throughout the organization? 2. What are the changes required for TQM Culture adoption in this organization? 3. Highlight the contribution of QC to improve quality in a department/function when organizations strive to realize organizational goals and objectives. 4. Do you feel TQM will help in Short Term and/or Long-Term Success? Give your own understanding. 5. How would you implement Kanban system for ABC Pharmaceutical? Give specific examples. 6. How would you implement Kaizen system for ABC Pharmaceutical? Give specific examples infer the consequence for evolution if speices did not vary (1 point) Assume that the monthly wondwide average number of airplaine crashes of commercial ailines is \( 2.2 \). What is the probability that there wili be (a) at most 3 such accidents in the next m Carlos is creating a 3D newspaper. He wants the text to be readable, but currently the lines are so close together that the bottoms of some letters (like y and p) touch the tops of some capital letters on the following line. What should he adjust to fix this problem?Question 11 options:formattingtrackingtypefacingleading ............................. 1. There are three buses A, B and C. the totalnumber of seats in the three buses is 250. 28% ofthe 250 seat are in bus A.number of seats in bus B:number of seats in busC = 3:238 of the seats in bus B are empty. 26 in bus Care empty.Jamie says the percentage of the seats in bus Bthat are empty is greater than the percentage ofthe seats in bus C that are empty. Is Jamiecorrect. Evaluate the traits of the ancient hero Odysseus. How do these traits influence our modern view of a hero? In an essay, appraise Odysseus's character traits and relate these to the character traits of the modern hero. What traits remain and what traits have changed? Why? PLEASE SHOW WORK!!!!!!!!! A rectangular bathroom tile is 2 and 1/3 times as wide as it is tall . If the tile is 5 cm tall,how wide is isA 3 and 2/3 cmB 7 and 1/3 cm C 10 and 1/3 cm Help me find the answer pls What is the measure of angle H? Explain what is the measure of angle i ? explain